Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MTRF1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Rabbit MTRF1L Polyclonal Antibody | anti-MTRF1L antibody

MTRF1L antibody - N-terminal region

Gene Names
MTRF1L; MRF1L; HMRF1L; mtRF1a
Reactivity
Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTRF1L; Polyclonal Antibody; MTRF1L antibody - N-terminal region; anti-MTRF1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL
Sequence Length
271
Applicable Applications for anti-MTRF1L antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MTRF1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MTRF1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-MTRF1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-MTRF1L antibody
This is a rabbit polyclonal antibody against MTRF1L. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.
Product Categories/Family for anti-MTRF1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
peptide chain release factor 1-like, mitochondrial isoform 3
NCBI Official Synonym Full Names
mitochondrial translational release factor 1 like
NCBI Official Symbol
MTRF1L
NCBI Official Synonym Symbols
MRF1L; HMRF1L; mtRF1a
NCBI Protein Information
peptide chain release factor 1-like, mitochondrial
UniProt Protein Name
Peptide chain release factor 1-like, mitochondrial
UniProt Gene Name
MTRF1L
UniProt Synonym Gene Names
MTRF1A
UniProt Entry Name
RF1ML_HUMAN

NCBI Description

The protein encoded by this gene plays a role in mitochondrial translation termination, and is thought to be a release factor that is involved in the dissociation of the complete protein from the final tRNA, the ribosome, and the cognate mRNA. This protein acts upon UAA and UAG stop codons, but has no in vitro activity against UGA, which encodes tryptophan in human mitochondrion, or, the mitochondrial non-cognate stop codons, AGA and AGG. This protein shares sequence similarity to bacterial release factors. Pseudogenes of this gene are found on chromosomes 4, 8, and 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]

Uniprot Description

MTRF1L: Mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG. Belongs to the prokaryotic/mitochondrial release factor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation

Chromosomal Location of Human Ortholog: 6q25-q26

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: translation release factor activity, codon specific

Biological Process: mitochondrial translation; organelle organization and biogenesis

Research Articles on MTRF1L

Similar Products

Product Notes

The MTRF1L mtrf1l (Catalog #AAA3212699) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTRF1L antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTRF1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTRF1L mtrf1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELFTRGGPLR TFLERQAGSE AHLKVRRPEL LAVIKLLNEK ERELRETEHL. It is sometimes possible for the material contained within the vial of "MTRF1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.