Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (GRK5 antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm and membrane of alveolar macrophagesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Rabbit GRK5 Polyclonal Antibody | anti-GRK5 antibody

GRK5 antibody - middle region

Gene Names
GRK5; GPRK5; FP2025
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GRK5; Polyclonal Antibody; GRK5 antibody - middle region; anti-GRK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
Sequence Length
590
Applicable Applications for anti-GRK5 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(GRK5 antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm and membrane of alveolar macrophagesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (GRK5 antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm and membrane of alveolar macrophagesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GRK5 antibody
This is a rabbit polyclonal antibody against GRK5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
G protein-coupled receptor kinase 5
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 5
NCBI Official Symbol
GRK5
NCBI Official Synonym Symbols
GPRK5; FP2025
NCBI Protein Information
G protein-coupled receptor kinase 5
UniProt Protein Name
G protein-coupled receptor kinase 5
UniProt Gene Name
GRK5
UniProt Synonym Gene Names
GPRK5
UniProt Entry Name
GRK5_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq, Jul 2008]

Uniprot Description

GRK5: Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein- coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their down-regulation. Phosphorylates a variety of GPCRs, including adrenergic receptors, muscarinic acetylcholine receptors (more specifically Gi-coupled M2/M4 subtypes), dopamine receptors and opioid receptors. In addition to GPCRs, also phosphorylates various substrates: Hsc70- interacting protein/ST13, TP53/p53, HDAC5, and arrestin-1/ARRB1. Phosphorylation of ARRB1 by GRK5 inhibits G-protein independent MAPK1/MAPK3 signaling downstream of 5HT4-receptors. Phosphorylation of HDAC5, a repressor of myocyte enhancer factor 2 (MEF2) leading to nuclear export of HDAC5 and allowing MEF2- mediated transcription. Phosphorylation of TP53/p53, a crucial tumor suppressor, inhibits TP53/p53-mediated apoptosis. Phosphorylation of ST13 regulates internalization of the chemokine receptor. Phosphorylates rhodopsin (RHO) (in vitro) and a non G- protein-coupled receptor, LRP6 during Wnt signaling (in vitro). Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; EC 2.7.11.16; Kinase, protein; AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 10q26.11

Cellular Component: nucleoplasm; nuclear membrane; focal adhesion; cytoplasm; plasma membrane; nucleus

Molecular Function: G-protein coupled receptor kinase activity; protein serine/threonine kinase activity; protein binding; protein kinase C binding; phospholipid binding; ATP binding

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; tachykinin signaling pathway; Wnt receptor signaling pathway; apoptosis; protein amino acid autophosphorylation; regulation of G-protein coupled receptor protein signaling pathway; negative regulation of apoptosis

Research Articles on GRK5

Similar Products

Product Notes

The GRK5 grk5 (Catalog #AAA3211841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRK5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the GRK5 grk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FYAAEILCGL EDLHRENTVY RDLKPENILL DDYGHIRISD LGLAVKIPEG. It is sometimes possible for the material contained within the vial of "GRK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.