Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- GRK5 Picoband antibody, MBS178163, Western blottingAll lanes: Anti GRK5 (MBS178163) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

GRK5 Polyclonal Antibody | anti-GRK5 antibody

Anti-GRK5 Antibody

Gene Names
GRK5; GPRK5
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
GRK5; Polyclonal Antibody; Anti-GRK5 Antibody; G protein-coupled receptor kinase 5; FLJ39780; FP2025; G protein coupled receptor kinase 5; G protein coupled receptor kinase GRK5; G protein-coupled receptor kinase GRK5; GPRK5; GRK-pan; GRK5_HUMAN; Pan-GRK; anti-GRK5 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
590
Applicable Applications for anti-GRK5 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- GRK5 Picoband antibody, MBS178163, Western blottingAll lanes: Anti GRK5 (MBS178163) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

Western Blot (WB) (Anti- GRK5 Picoband antibody, MBS178163, Western blottingAll lanes: Anti GRK5 (MBS178163) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD )

Immunohistochemistry (IHC)

(Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Rat Cardiac Muscle Tissue )

Immunohistochemistry (IHC) (Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Rat Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Mouse Lung Tissue )

Immunohistochemistry (IHC) (Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Mouse Lung Tissue )

Immunohistochemistry (IHC)

(Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Human Placenta Tissue )

Immunohistochemistry (IHC) (Anti- GRK5 Picoband antibody, MBS178163,IHC(P)IHC(P): Human Placenta Tissue )

Western Blot (WB)

(Applications: Western BlotSample: Rat endothelial cellsDetection: Kodak Image Station 4000R Pro;Thermo Scientific West Femto Maximum Sensitivity Substrate"After using this antibody for western blot to analyze rat endothelial cells' protein, I found MBS178163 Anti-GRK5 antibody worked very well. The blot of 68 Kda can be seen, however, we can see another 3 blots at least. In a word, Anti GRK5 (PB 9708) is useful and good. The blot of 68 Kda can be detected.")

Western Blot (WB) (Applications: Western BlotSample: Rat endothelial cellsDetection: Kodak Image Station 4000R Pro;Thermo Scientific West Femto Maximum Sensitivity Substrate"After using this antibody for western blot to analyze rat endothelial cells' protein, I found MBS178163 Anti-GRK5 antibody worked very well. The blot of 68 Kda can be seen, however, we can see another 3 blots at least. In a word, Anti GRK5 (PB 9708) is useful and good. The blot of 68 Kda can be detected.")
Related Product Information for anti-GRK5 antibody
Description: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 5(GRK5) detection. Tested with WB, IHC-P in Human;Rat;Mouse.

Background: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).
References
1. "Entrez Gene: GRK5 G protein-coupled receptor kinase 5". 2. Bullrich F, Druck T, Kunapuli P, et al. (1995). "Chromosomal mapping of the genes GPRK5 and GPRK6 encoding G protein-coupled receptor kinases GRK5 and GRK6.". Cytogenet. Cell Genet. 70 (3-4): 250-4. 3. Kunapuli P, Benovic JL (Jul 1993). "Cloning and expression of GRK5: a member of the G protein-coupled receptor kinase family". Proc Natl Acad Sci U S A 90 (12): 5588-92.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,787 Da
NCBI Official Full Name
G protein-coupled receptor kinase 5
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 5
NCBI Official Symbol
GRK5
NCBI Official Synonym Symbols
GPRK5
NCBI Protein Information
G protein-coupled receptor kinase 5
UniProt Protein Name
G protein-coupled receptor kinase 5
UniProt Gene Name
GRK5
UniProt Synonym Gene Names
GPRK5
UniProt Entry Name
GRK5_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq, Jul 2008]

Uniprot Description

GRK5: Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein- coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their down-regulation. Phosphorylates a variety of GPCRs, including adrenergic receptors, muscarinic acetylcholine receptors (more specifically Gi-coupled M2/M4 subtypes), dopamine receptors and opioid receptors. In addition to GPCRs, also phosphorylates various substrates: Hsc70- interacting protein/ST13, TP53/p53, HDAC5, and arrestin-1/ARRB1. Phosphorylation of ARRB1 by GRK5 inhibits G-protein independent MAPK1/MAPK3 signaling downstream of 5HT4-receptors. Phosphorylation of HDAC5, a repressor of myocyte enhancer factor 2 (MEF2) leading to nuclear export of HDAC5 and allowing MEF2- mediated transcription. Phosphorylation of TP53/p53, a crucial tumor suppressor, inhibits TP53/p53-mediated apoptosis. Phosphorylation of ST13 regulates internalization of the chemokine receptor. Phosphorylates rhodopsin (RHO) (in vitro) and a non G- protein-coupled receptor, LRP6 during Wnt signaling (in vitro). Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; EC 2.7.11.16; AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 10q26.11

Cellular Component: cytoplasm; focal adhesion; nuclear membrane; nucleus; plasma membrane

Molecular Function: ATP binding; beta-adrenergic receptor kinase activity; G-protein coupled receptor kinase activity; phospholipid binding; protein binding; protein kinase C binding; protein serine/threonine kinase activity

Biological Process: apoptosis; desensitization of G-protein coupled receptor protein signaling pathway; fat cell differentiation; G-protein signaling, coupled to cAMP nucleotide second messenger; negative regulation of apoptosis; positive regulation of cell proliferation; protein amino acid autophosphorylation; regulation of cell cycle; regulation of G-protein coupled receptor protein signaling pathway; response to drug; tachykinin signaling pathway; Wnt receptor signaling pathway

Research Articles on GRK5

Similar Products

Product Notes

The GRK5 grk5 (Catalog #AAA178163) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-GRK5 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the GRK5 grk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.