Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DBNL Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Rabbit DBNL Polyclonal Antibody | anti-DBNL antibody

DBNL antibody - middle region

Gene Names
DBNL; ABP1; HIP55; SH3P7; HIP-55
Reactivity
Dog, Guinea Pig, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DBNL; Polyclonal Antibody; DBNL antibody - middle region; anti-DBNL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
Sequence Length
430
Applicable Applications for anti-DBNL antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 79%; Human: 100%; Mouse: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DBNL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DBNL Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-DBNL Antibody Titration: 0.2-1 ug/mlPositive Control: Human Muscle)
Related Product Information for anti-DBNL antibody
This is a rabbit polyclonal antibody against DBNL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. DBNL acts as a k
Product Categories/Family for anti-DBNL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
drebrin-like protein isoform b
NCBI Official Synonym Full Names
drebrin like
NCBI Official Symbol
DBNL
NCBI Official Synonym Symbols
ABP1; HIP55; SH3P7; HIP-55
NCBI Protein Information
drebrin-like protein
UniProt Protein Name
Drebrin-like protein
Protein Family
UniProt Gene Name
DBNL
UniProt Synonym Gene Names
CMAP; SH3P7; HIP-55
UniProt Entry Name
DBNL_HUMAN

Uniprot Description

DBNL: an SH3-containing adaptor protein. Interacts with hematopoietic progenitor kinase 1a (HIPK1). It is recruited to glycolipid-enriched microdomains following T cell receptor (TCR) stimulation. Interacts with and is phosphorylated by ZAP-70 after TCR signaling. May regulate JNK activation following TCR signaling, presumably via its interaction with HIPKIt is a member of the drebrin family of proteins that are developmentally regulated in the brain.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: Golgi membrane; ruffle; lamellipodium; dendrite; postsynaptic density; cytoplasm; plasma membrane; clathrin coated vesicle membrane; podosome; cell cortex; cytosol; cell junction

Molecular Function: actin filament binding; protein C-terminus binding; protein domain specific binding; protein binding; enzyme activator activity; actin binding

Biological Process: receptor-mediated endocytosis; synaptogenesis; immune system process; apoptosis; Rac protein signal transduction; neurite morphogenesis; activation of JNK activity; cell structure disassembly during apoptosis

Research Articles on DBNL

Similar Products

Product Notes

The DBNL dbnl (Catalog #AAA3211668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBNL antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DBNL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DBNL dbnl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QESAVHPREI FKQKERAMST TSISSPQPGK LRSPFLQKQL TQPETHFGRE. It is sometimes possible for the material contained within the vial of "DBNL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.