Western Blot (WB)
(WB Suggested Anti-Il5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Rabbit Il5 Polyclonal Antibody | anti-IL5 antibody
Il5 antibody - middle region
Gene Names
Il5; Il-5
Reactivity
Tested Reactivity: MousePredicted Reactivity: Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Il5; Polyclonal Antibody; Il5 antibody - middle region; anti-IL5 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Reactivity: Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL
Applicable Applications for anti-IL5 antibody
Western Blot (WB)
Protein Size (# AA)
133 amino acids
Protein Interactions
Gata3; Ifng; H3f3a;
Blocking Peptide
For anti-Il5 (MBS3211621) antibody is MBS3236570
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Replacement Item
This antibody may replace item sc-34812 from Santa Cruz Biotechnology.
Predicted Homology
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Il5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Western Blot (WB)
(WB Suggested Anti-Il5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Related Product Information for anti-IL5 antibody
This is a rabbit polyclonal antibody against Il5. It was validated on Western Blot
Target Description: The function of Il5 remains unknown.
Target Description: The function of Il5 remains unknown.
Product Categories/Family for anti-IL5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
interleukin-5
NCBI Official Synonym Full Names
interleukin 5
NCBI Official Symbol
Il5
NCBI Official Synonym Symbols
Il-5
NCBI Protein Information
interleukin-5
UniProt Protein Name
Interleukin-5
Protein Family
UniProt Gene Name
Il5
UniProt Synonym Gene Names
Il-5; IL-5; BCGF-II; TRF
UniProt Entry Name
IL5_MOUSE
Uniprot Description
IL5: Factor that induces terminal differentiation of late- developing B-cells to immunoglobulin secreting cells. Belongs to the IL-5 family.
Protein type: Secreted, signal peptide; Cytokine; Secreted
Cellular Component: extracellular space; extracellular region
Molecular Function: interleukin-5 receptor binding; growth factor activity; cytokine activity
Biological Process: positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of cell proliferation; positive regulation of B cell proliferation; positive regulation of JAK-STAT cascade; immune response; positive regulation of transcription factor activity; positive regulation of immunoglobulin secretion; positive regulation of eosinophil differentiation
Research Articles on IL5
Similar Products
Product Notes
The IL5 il5 (Catalog #AAA3211621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Il5 antibody - middle region reacts with Tested Reactivity: Mouse Predicted Reactivity: Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Il5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL5 il5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEIPMSTVVK ETLTQLSAHR ALLTSNETMR LPVPTHKNHQ LCIGEIFQGL. It is sometimes possible for the material contained within the vial of "Il5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
