Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APH1BSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit APH1B Polyclonal Antibody | anti-APH1B antibody

APH1B Antibody - N-terminal region

Gene Names
APH1B; PSFL; APH-1B; PRO1328; TAAV688
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APH1B; Polyclonal Antibody; APH1B Antibody - N-terminal region; anti-APH1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE
Sequence Length
257
Applicable Applications for anti-APH1B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human APH1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APH1BSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APH1BSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-APH1B antibody
This is a rabbit polyclonal antibody against APH1B. It was validated on Western Blot

Target Description: This gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.
Product Categories/Family for anti-APH1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
gamma-secretase subunit APH-1B isoform 1
NCBI Official Synonym Full Names
aph-1 homolog B, gamma-secretase subunit
NCBI Official Symbol
APH1B
NCBI Official Synonym Symbols
PSFL; APH-1B; PRO1328; TAAV688
NCBI Protein Information
gamma-secretase subunit APH-1B
UniProt Protein Name
Gamma-secretase subunit APH-1B
Protein Family
UniProt Gene Name
APH1B
UniProt Synonym Gene Names
PSFL; APH-1b
UniProt Entry Name
APH1B_HUMAN

NCBI Description

This gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein. [provided by RefSeq, Sep 2011]

Uniprot Description

APH1B: Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Probably present in a minority of gamma-secretase complexes compared to APH1A. Belongs to the APH-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: integral to membrane; plasma membrane; transport vesicle

Molecular Function: peptidase activity; protein binding

Biological Process: ephrin receptor signaling pathway; membrane protein intracellular domain proteolysis; Notch receptor processing; Notch signaling pathway; positive regulation of apoptosis; positive regulation of catalytic activity; protein processing

Research Articles on APH1B

Similar Products

Product Notes

The APH1B aph1b (Catalog #AAA3211527) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APH1B Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APH1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APH1B aph1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIDNKDGPTQ KYLLIFGAFV SVYIQEMFRF AYYKLLKKAS EGLKSINPGE. It is sometimes possible for the material contained within the vial of "APH1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.