Western Blot (WB)
(WB Suggested Anti-FAM46D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Rabbit TENT5D Polyclonal Antibody | anti-TENT5D antibody
TENT5D Antibody - middle region
Gene Names
TENT5D; CT112; CT1.26; FAM46D
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TENT5D; Polyclonal Antibody; TENT5D Antibody - middle region; anti-TENT5D antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM
Sequence Length
389
Applicable Applications for anti-TENT5D antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FAM46D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FAM46D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-FAM46D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TENT5D antibody
This is a rabbit polyclonal antibody against FAM46D. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown.
Target Description: Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown.
Product Categories/Family for anti-TENT5D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
terminal nucleotidyltransferase 5D
NCBI Official Synonym Full Names
terminal nucleotidyltransferase 5D
NCBI Official Symbol
TENT5D
NCBI Official Synonym Symbols
CT112; CT1.26; FAM46D
NCBI Protein Information
terminal nucleotidyltransferase 5D; putative nucleotidyltransferase FAM46D
UniProt Protein Name
Protein FAM46D
UniProt Gene Name
FAM46D
UniProt Entry Name
FA46D_HUMAN
NCBI Description
Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown. [provided by RefSeq, Dec 2009]
Research Articles on TENT5D
Similar Products
Product Notes
The TENT5D fam46d (Catalog #AAA3211120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TENT5D Antibody - middle region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's TENT5D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TENT5D fam46d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPNTQKVTCF YQPAPYFAAE ARYPIYVIPE PPPVSFQPYH PLHFRGSNGM. It is sometimes possible for the material contained within the vial of "TENT5D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
