Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POLI Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit POLI Polyclonal Antibody | anti-POLI antibody

POLI antibody - N-terminal region

Gene Names
POLI; eta2; RAD30B; RAD3OB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLI; Polyclonal Antibody; POLI antibody - N-terminal region; anti-POLI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD
Sequence Length
740
Applicable Applications for anti-POLI antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POLI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POLI Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-POLI Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-POLI antibody
This is a rabbit polyclonal antibody against POLI. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.POLI exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine.POLI may play a role in hypermutation of immunogobulin genes.POLI forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83
NCBI Official Full Name
DNA polymerase iota isoform a (long)
NCBI Official Synonym Full Names
DNA polymerase iota
NCBI Official Symbol
POLI
NCBI Official Synonym Symbols
eta2; RAD30B; RAD3OB
NCBI Protein Information
DNA polymerase iota
UniProt Protein Name
DNA polymerase iota
Protein Family
UniProt Gene Name
POLI
UniProt Synonym Gene Names
RAD30B
UniProt Entry Name
POLI_HUMAN

NCBI Description

The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion. [provided by RefSeq, May 2017]

Uniprot Description

POLI: Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity. Belongs to the DNA polymerase type-Y family.

Protein type: EC 2.7.7.7; DNA repair, damage; Transferase

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; intracellular; nucleus

Molecular Function: protein binding; metal ion binding; damaged DNA binding; DNA-directed DNA polymerase activity

Biological Process: DNA repair; DNA replication

Research Articles on POLI

Similar Products

Product Notes

The POLI poli (Catalog #AAA3210716) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLI antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLI poli for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVVERLGFDE NFVDLTEMVE KRLQQLQSDE LSAVTVSGHV YNNQSINLLD. It is sometimes possible for the material contained within the vial of "POLI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.