Western Blot (WB)
(WB Suggested Anti-Pnck AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Rabbit Pnck Polyclonal Antibody | anti-PNCK antibody
Pnck antibody - C-terminal region
Gene Names
Pnck; Punc; Bstk3; Camk1b; CaMKlb2; caMKlb1; CaMKIbeta2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pnck; Polyclonal Antibody; Pnck antibody - C-terminal region; anti-PNCK antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS
Sequence Length
343
Applicable Applications for anti-PNCK antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Pnck AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Pnck AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-PNCK antibody
This is a rabbit polyclonal antibody against Pnck. It was validated on Western Blot
Target Description: Pnck is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro, Pnck phosphorylates CREB1 and SYN1/synapsin I and phosphorylates and activates CAMK1.
Target Description: Pnck is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro, Pnck phosphorylates CREB1 and SYN1/synapsin I and phosphorylates and activates CAMK1.
Product Categories/Family for anti-PNCK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1B
NCBI Official Synonym Full Names
pregnancy upregulated non-ubiquitously expressed CaM kinase
NCBI Official Symbol
Pnck
NCBI Official Synonym Symbols
Punc; Bstk3; Camk1b; CaMKlb2; caMKlb1; CaMKIbeta2
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1B
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1B
Protein Family
UniProt Gene Name
Pnck
UniProt Synonym Gene Names
CaM kinase IB; CaM-KI beta; CaMKI-beta
UniProt Entry Name
KCC1B_MOUSE
Similar Products
Product Notes
The PNCK pnck (Catalog #AAA3210473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pnck antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Pnck can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNCK pnck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAVDVWALGV ISYILLCGYP PFYDESDPEL FSQILRASYE FDSPFWDDIS. It is sometimes possible for the material contained within the vial of "Pnck, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
