Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PNCK expression in transfected 293T cell line by PNCK polyclonal antibody. Lane 1: PNCK transfected lysate (13.31kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PNCK Polyclonal Antibody | anti-PNCK antibody

PNCK (Calcium/Calmodulin-dependent Protein Kinase Type 1B, CaM Kinase I beta, CaM Kinase IB, CaM-KI beta, CaMKI-beta, Pregnancy Up-regulated Non-ubiquitously-expressed CaM Kinase, BSTK3, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419)

Gene Names
PNCK; BSTK3; CaMK1b
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PNCK; Polyclonal Antibody; PNCK (Calcium/Calmodulin-dependent Protein Kinase Type 1B; CaM Kinase I beta; CaM Kinase IB; CaM-KI beta; CaMKI-beta; Pregnancy Up-regulated Non-ubiquitously-expressed CaM Kinase; BSTK3; FLJ50403; FLJ50549; FLJ56451; FLJ59811; MGC45419); Anti -PNCK (Calcium/Calmodulin-dependent Protein Kinase Type 1B; anti-PNCK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PNCK.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL
Applicable Applications for anti-PNCK antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PNCK, aa1-121 (AAH33746.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PNCK expression in transfected 293T cell line by PNCK polyclonal antibody. Lane 1: PNCK transfected lysate (13.31kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PNCK expression in transfected 293T cell line by PNCK polyclonal antibody. Lane 1: PNCK transfected lysate (13.31kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PNCK antibody
Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates CREB1 and SYN1/synapsin I. Phosphorylates and activates CAMK1.
Product Categories/Family for anti-PNCK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
38,500 Da
NCBI Official Full Name
PNCK protein
NCBI Official Synonym Full Names
pregnancy up-regulated non-ubiquitously expressed CaM kinase
NCBI Official Symbol
PNCK
NCBI Official Synonym Symbols
BSTK3; CaMK1b
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1B; caMKI-beta; caM-KI beta; caM kinase IB; caM kinase I beta; pregnancy upregulated non-ubiquitously expressed CaM kinase; pregnancy up-regulated non-ubiquitously-expressed CaM kinase
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1B
UniProt Gene Name
PNCK
UniProt Synonym Gene Names
CaM kinase IB; CaM-KI beta; CaMKI-beta
UniProt Entry Name
KCC1B_HUMAN

NCBI Description

PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates CREB1 and SYN1/synapsin I. Phosphorylates and activates CAMK1

By similarity.

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Enzyme regulation: Activated by Ca2+/calmodulin

By similarity.

Subcellular location: Cytoplasm

By similarity. Nucleus

By similarity.

Post-translational modification: Phosphorylated by CAMKK1

Probable.

Sequence similarities: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.Contains 1 protein kinase domain.

Research Articles on PNCK

Similar Products

Product Notes

The PNCK pnck (Catalog #AAA648223) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PNCK (Calcium/Calmodulin-dependent Protein Kinase Type 1B, CaM Kinase I beta, CaM Kinase IB, CaM-KI beta, CaMKI-beta, Pregnancy Up-regulated Non-ubiquitously-expressed CaM Kinase, BSTK3, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PNCK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PNCK pnck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLLKKHTED ISSVYEIRER LGSGPSPLHS LSLLPLLSSH FLPTSHRPVC GRGAFSEVVL AQERGSAHLV ALKCIPKKAL RGKEALVENE IAVLRRISHP NIVALEDVHE SPSHLYLAME L. It is sometimes possible for the material contained within the vial of "PNCK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.