Western Blot (WB)
(WB Suggested Anti-PAXIP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysatePAXIP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit PAXIP1 Polyclonal Antibody | anti-PAXIP1 antibody
PAXIP1 antibody - N-terminal region
Gene Names
PAXIP1; PTIP; TNRC2; CAGF28; CAGF29; PACIP1; PAXIP1L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PAXIP1; Polyclonal Antibody; PAXIP1 antibody - N-terminal region; anti-PAXIP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
Sequence Length
697
Applicable Applications for anti-PAXIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PAXIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PAXIP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysatePAXIP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-PAXIP1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysatePAXIP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PAXIP1 antibody
This is a rabbit polyclonal antibody against PAXIP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PAXIP1 functions as a key component of the DNA damage response, and phosphoserine or phosphothreonine-specific binding modules. PAXIP1 recognizes substrates phosphorylated by the kinases ataxia telangiectasia-mutated (ATM), ataxia telangiectasia and RAD3-related (ATR) in response to gamma irradiation. It may play a role in PAX2-dependent transcriptional regulation. PAXIP1 plays a role in early development, most probably in cell proliferation.
Target Description: PAXIP1 functions as a key component of the DNA damage response, and phosphoserine or phosphothreonine-specific binding modules. PAXIP1 recognizes substrates phosphorylated by the kinases ataxia telangiectasia-mutated (ATM), ataxia telangiectasia and RAD3-related (ATR) in response to gamma irradiation. It may play a role in PAX2-dependent transcriptional regulation. PAXIP1 plays a role in early development, most probably in cell proliferation.
Product Categories/Family for anti-PAXIP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
PAX interacting (with transcription-activation domain) protein 1, isoform CRA_b
NCBI Official Synonym Full Names
PAX interacting protein 1
NCBI Official Symbol
PAXIP1
NCBI Official Synonym Symbols
PTIP; TNRC2; CAGF28; CAGF29; PACIP1; PAXIP1L
NCBI Protein Information
PAX-interacting protein 1
UniProt Protein Name
PAX-interacting protein 1
Protein Family
UniProt Gene Name
PAXIP1
UniProt Synonym Gene Names
PAXIP1L; PTIP
UniProt Entry Name
PAXI1_HUMAN
NCBI Description
This gene is a member of the paired box (PAX) gene family and encodes a nuclear protein with six BRCT (breast cancer carboxy-terminal) domains. This protein plays a critical role in maintaining genome stability, condensation of chromatin and progression through mitosis. [provided by RefSeq, Jul 2008]
Research Articles on PAXIP1
Similar Products
Product Notes
The PAXIP1 paxip1 (Catalog #AAA3210355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAXIP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PAXIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAXIP1 paxip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFDDSSDSSP EKQERNLNWT PAEVPQLAAA KRRLPQGKEP GLINLCANVP. It is sometimes possible for the material contained within the vial of "PAXIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
