Mouse anti-Human PAXIP1 Monoclonal Antibody | anti-PAXIP1 antibody

PAXIP1 (PAX-interacting Protein 1, PAX Transactivation Activation Domain-interacting Protein, PAXIP1L, PTIP, CAGF28, CAGF29, FLJ41049, TNRC2)

Cat. Num. AAA645736

• Gene Names: PAXIP1; PTIP; TNRC2; CAGF28; CAGF29; PACIP1; PAXIP1L
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PAXIP1; Monoclonal Antibody; PAXIP1 (PAX-interacting Protein 1; PAX Transactivation Activation Domain-interacting Protein; PAXIP1L; PTIP; CAGF28; CAGF29; FLJ41049; TNRC2); Anti -PAXIP1 (PAX-interacting Protein 1; anti-PAXIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C11
• Specificity: Recognizes human PAXIP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: HLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSF*

• Applicable Applications for anti-PAXIP1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa868-976 from PAXIP1 with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Testing Data

(Detection limit for recombinant GST tagged PAXIP1 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-PAXIP1 antibody

Involved in DNA damage response and in transcriptional regulation through histone methyltransferase (HMT) complexes. Plays a role in early development. In DNA damage response is required for cell survival after ionizing radiation. In vitro shown to be involved in the homologous recombination mechanism for the repair of double-strand breaks (DSBs). Its localization to DNA damage foci requires RNF8 and UBE2N. Recruits TP53BP1 to DNA damage foci and, at least in particular repair processes, effective DNA damage response appears to require the association with TP53BP1 phosphorylated by ATM at 'Ser-25'. Together with TP53BP1 regulates ATM association. Recruits PAGR1 to sites of DNA damage and the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage; the function is probbaly independent of MLL-containing histone methyltransferase (HMT) complexes. Promotes ubiquitination of PCNA following UV irradiation and may regulate recruitment of polymerase eta and RAD51 to chromatin after DNA damage. Proposed to be involved in transcriptional regulation by linking MLL-containing histone methyltransferase (HMT) complexes to gene promoters by interacting with promoter-bound transcription factors such as PAX2. Associates with gene promoters that are known to be regulated by MLL2. During immunoglobulin class switching in activated B-cells is involved in trimethylation of histone H3 at 'Lys-4' and in transcription initiation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus; this function appears to involve the recruitment of MLL-containing HMT complexes.

Product Categories/Family for anti-PAXIP1 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 93141033
• NCBI GeneID: 22976
• NCBI Accession #: NP_031375.3
• NCBI GenBank Nucleotide #: NM_007349.3
• UniProt Accession #: Q6ZW49; O15404; Q6N099; Q6ZWH9; Q7Z315; Q86UN0; Q8N4P9; Q96HP2
• Molecular Weight: 121,341 Da
• NCBI Official Full Name: PAX-interacting protein 1
• NCBI Official Synonym Full Names: PAX interacting (with transcription-activation domain) protein 1
• NCBI Official Symbol: PAXIP1
• NCBI Official Synonym Symbols: PTIP; TNRC2; CAGF28; CAGF29; PACIP1; PAXIP1L
• NCBI Protein Information: PAX-interacting protein 1; protein encoded by CAG trinucleotide repeats; PAX transcription activation domain interacting protein 1 like
• UniProt Protein Name: PAX-interacting protein 1
• Protein Family: PAX-interacting protein
• UniProt Gene Name: PAXIP1
• UniProt Synonym Gene Names: PAXIP1L; PTIP
• UniProt Entry Name: PAXI1_HUMAN

NCBI Description

This gene is a member of the paired box (PAX) gene family and encodes a nuclear protein with six BRCT (breast cancer carboxy-terminal) domains. This protein plays a critical role in maintaining genome stability, condensation of chromatin and progression through mitosis. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Involved in DNA damage response and in transcriptional regulation through histone methyltransferase (HMT) complexes. Plays a role in early development. In DNA damage response is required for cell survival after ionizing radiation. In vitro shown to be involved in the homologous recombination mechanism for the repair of double-strand breaks (DSBs). Its localization to DNA damage foci requires RNF8 and UBE2N. Recruits TP53BP1 to DNA damage foci and, at least in particular repair processes, effective DNA damage response appears to require the association with TP53BP1 phosphorylated by ATM at 'Ser-25'. Together with TP53BP1 regulates ATM association. Recruits PAGR1 to sites of DNA damage and the PAGR1:PAXIP1 complex is required for cell survival in response to DNA damage; the function is probbaly independent of MLL-containing histone methyltransferase (HMT) complexes. Promotes ubiquitination of PCNA following UV irradiation and may regulate recruitment of polymerase eta and RAD51 to chromatin after DNA damage. Proposed to be involved in transcriptional regulation by linking MLL-containing histone methyltransferase (HMT) complexes to gene promoters by interacting with promoter-bound transcription factors such as PAX2. Associates with gene promoters that are known to be regulated by KMT2D/MLL2. During immunoglobulin class switching in activated B-cells is involved in trimethylation of histone H3 at 'Lys-4' and in transcription initiation of downstream switch regions at the immunoglobulin heavy-chain (Igh) locus; this function appears to involve the recruitment of MLL-containing HMT complexes. Ref.6 Ref.7 Ref.8 Ref.11 Ref.13 Ref.15

Subunit structure: Interacts with the C-terminal transactivation domain of PAX2

By similarity. Interacts with PAGR1; the interaction is direct and also occurs independent of MLL-containing complexes. Interacts with TP53BP1 (phosphorylated at 'Ser-25'). Interacts with HLTF. Component of the MLL2/3 complex (also named ASCOM complex), at least composed of KMT2D/MLL2 or KMT2C/MLL3, ASH2L, RBBP5, WDR5, NCOA6, DPY30, KDM6A, PAXIP1/PTIP, PAGR1 and alpha- and beta-tubulin. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14

Subcellular location: Nucleus matrix

By similarity. Note: Localizes to DNA damage foci upon ionizing radiation. Ref.7 Ref.11

Domain: The BRCT 5 and 6 domains function as a single module and are necessary and sufficient for in vitro phospho-specific binding (substrates phosphorylated by the kinases ataxia telangiectasia-mutated (ATM), ataxia telangiectasia and RAD3-related (ATR) in response to gamma irradiation). In contrast, in vivo two pairs of BRCT domains (3-6) bind to phosphorylated TP53BP1 much more efficiently.

Sequence similarities: Contains 6 BRCT domains.

Sequence caution: The sequence AAB91434.1 differs from that shown. Reason: Frameshift at positions 643 and 662. The sequence AAH33781.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAH33781.1 differs from that shown. Reason: Contaminating sequence.The sequence AAP21865.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAC85523.1 differs from that shown. Reason: Intron retention.