Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CDCA4 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateCDCA4 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit CDCA4 Polyclonal Antibody | anti-CDCA4 antibody

CDCA4 antibody - N-terminal region

Gene Names
CDCA4; HEPP; SEI-3/HEPP
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CDCA4; Polyclonal Antibody; CDCA4 antibody - N-terminal region; anti-CDCA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM
Sequence Length
241
Applicable Applications for anti-CDCA4 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CDCA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CDCA4 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateCDCA4 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-CDCA4 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysateCDCA4 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-CDCA4 antibody
This is a rabbit polyclonal antibody against CDCA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells.The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene.
Product Categories/Family for anti-CDCA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
cell division cycle-associated protein 4
NCBI Official Synonym Full Names
cell division cycle associated 4
NCBI Official Symbol
CDCA4
NCBI Official Synonym Symbols
HEPP; SEI-3/HEPP
NCBI Protein Information
cell division cycle-associated protein 4
UniProt Protein Name
Cell division cycle-associated protein 4
UniProt Gene Name
CDCA4
UniProt Synonym Gene Names
HEPP
UniProt Entry Name
CDCA4_HUMAN

NCBI Description

This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulation of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq, May 2014]

Uniprot Description

CDCA4: May participate in the regulation of cell proliferation through the E2F/RB pathway. May be involved in molecular regulation of hematopoietic stem cells and progenitor cell lineage commitment and differentiation.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: nucleus

Molecular Function: protein binding

Research Articles on CDCA4

Similar Products

Product Notes

The CDCA4 cdca4 (Catalog #AAA3210016) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDCA4 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDCA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDCA4 cdca4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFARGLKRKC VGHEEDVEGA LAGLKTVSSY SLQRQSLLDM SLVKLQLCHM. It is sometimes possible for the material contained within the vial of "CDCA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.