Western Blot (WB)
(WB Suggested Anti-DLL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Rabbit DLL4 Polyclonal Antibody | anti-DLL4 antibody
DLL4 antibody - N-terminal region
Gene Names
DLL4; AOS6; delta4; hdelta2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLL4; Polyclonal Antibody; DLL4 antibody - N-terminal region; anti-DLL4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF
Sequence Length
685
Applicable Applications for anti-DLL4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%; Yeast: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DLL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DLL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-DLL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-DLL4 antibody
This is a rabbit polyclonal antibody against DLL4. It was validated on Western Blot
Target Description: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-DLL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
delta-like protein 4
NCBI Official Synonym Full Names
delta like canonical Notch ligand 4
NCBI Official Symbol
DLL4
NCBI Official Synonym Symbols
AOS6; delta4; hdelta2
NCBI Protein Information
delta-like protein 4
UniProt Protein Name
Delta-like protein 4
Protein Family
UniProt Gene Name
DLL4
UniProt Synonym Gene Names
Delta4
NCBI Description
This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008]
Uniprot Description
Involved in the Notch signaling pathway as Notch ligand (PubMed:11134954). Activates NOTCH1 and NOTCH4. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting (PubMed:20616313). Essential for retinal progenitor proliferation. Required for suppressing rod fates in late retinal progenitors as well as for proper generation of other retinal cell types (). During spinal cord neurogenesis, inhibits V2a interneuron fate (PubMed:17728344).
Research Articles on DLL4
Similar Products
Product Notes
The DLL4 dll4 (Catalog #AAA3209452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLL4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's DLL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLL4 dll4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGSLAVGQNW LLDEQTSTLT RLRYSYRVIC SDNYYGDNCS RLCKKRNDHF. It is sometimes possible for the material contained within the vial of "DLL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
