Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human DLL4 Monoclonal Antibody | anti-DLL4 antibody

DLL4 (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO434, MGC126344) (FITC)

Gene Names
DLL4; hdelta2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLL4; Monoclonal Antibody; DLL4 (Delta-like Protein 4; Drosophila Delta Homolog 4; Delta4; UNQ1895/PRO434; MGC126344) (FITC); anti-DLL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Specificity
Recognizes human DLL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DLL4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa123-222 from human DLL4 (NP_061947) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged DLL4 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DLL4 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-DLL4 antibody
DLL4 is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain.
Product Categories/Family for anti-DLL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,605 Da
NCBI Official Full Name
delta-like protein 4
NCBI Official Synonym Full Names
delta-like 4 (Drosophila)
NCBI Official Symbol
DLL4
NCBI Official Synonym Symbols
hdelta2
NCBI Protein Information
delta-like protein 4; delta 4; delta ligand 4; delta-like 4 homolog; delta-like 4 protein; delta4; drosophila Delta homolog 4; notch ligand DLL4; notch ligand delta-2
UniProt Protein Name
Delta-like protein 4
Protein Family
UniProt Gene Name
DLL4
UniProt Synonym Gene Names
Delta4

Uniprot Description

Involved in the Notch signaling pathway as Notch ligand (PubMed:11134954). Activates NOTCH1 and NOTCH4. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting (PubMed:20616313). Essential for retinal progenitor proliferation. Required for suppressing rod fates in late retinal progenitors as well as for proper generation of other retinal cell types (). During spinal cord neurogenesis, inhibits V2a interneuron fate (PubMed:17728344).

Similar Products

Product Notes

The DLL4 dll4 (Catalog #AAA6146859) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLL4 (Delta-like Protein 4, Drosophila Delta Homolog 4, Delta4, UNQ1895/PRO434, MGC126344) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLL4 dll4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.