Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateMAP3K2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit MAP3K2 Polyclonal Antibody | anti-MAP3K2 antibody

MAP3K2 antibody - N-terminal region

Gene Names
MAP3K2; MEKK2; MEKK2B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAP3K2; Polyclonal Antibody; MAP3K2 antibody - N-terminal region; anti-MAP3K2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
Sequence Length
619
Applicable Applications for anti-MAP3K2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 80%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateMAP3K2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateMAP3K2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-MAP3K2 antibody
This is a rabbit polyclonal antibody against MAP3K2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-18 AF111105.1 37-54 19-79 AI760702.1 474-534 80-371 AF111105.1 116-407 372-2650 AB208963.1 313-2591 2651-3557 AK075004.1 2050-2956 3558-3571 BQ423724.1 71-84 3572-3577 W07290.1 11-16 3578-4302 AK074577.1 1-725 4303-4421 BM470563.1 21-139 4422-4424 AK074577.1 845-847 4425-4941 BM470563.1 142-658

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 2
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 2
NCBI Official Symbol
MAP3K2
NCBI Official Synonym Symbols
MEKK2; MEKK2B
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 2
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 2
UniProt Gene Name
MAP3K2
UniProt Synonym Gene Names
MAPKKK2; MEKK2; MEK kinase 2; MEKK 2
UniProt Entry Name
M3K2_HUMAN

NCBI Description

The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. [provided by RefSeq, Jul 2008]

Uniprot Description

MEKK2: a protein kinase of the STE11 family. Phosphorylates and activates MEK5. Involved in growth factor stimulated cell proliferation and differentiation.

Protein type: Kinase, protein; Protein kinase, STE; EC 2.7.11.25; Protein kinase, Ser/Thr (non-receptor); STE group; STE11 family

Chromosomal Location of Human Ortholog: 2q14.3

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase activity; metal ion binding; protein kinase binding; ATP binding; protein kinase activity

Biological Process: activation of MAPKK activity; activation of MAPK activity; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; activation of JNK activity

Research Articles on MAP3K2

Similar Products

Product Notes

The MAP3K2 map3k2 (Catalog #AAA3209372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP3K2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAP3K2 map3k2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AERKKRLSII GPTSRDRSSP PPGYIPDELH QVARNGSFTS INSEGEFIPE. It is sometimes possible for the material contained within the vial of "MAP3K2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.