Western Blot (WB)
(Host: RabbitTarget Name: GPAT2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human GPAT2 Polyclonal Antibody | anti-GPAT2 antibody
GPAT2 Antibody - N-terminal region
Gene Names
GPAT2; CT123
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPAT2; Polyclonal Antibody; GPAT2 Antibody - N-terminal region; anti-GPAT2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATMLEGRCQTQPRSSPSGREASLWSSGFGMKLEAVTPFLGKYRPFVGRC
Sequence Length
671
Applicable Applications for anti-GPAT2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GPAT2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GPAT2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPAT2 antibody
This is a rabbit polyclonal antibody against GPAT2. It was validated on Western Blot
Target Description: GPAT2 esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
Target Description: GPAT2 esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
Product Categories/Family for anti-GPAT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Synonym Full Names
glycerol-3-phosphate acyltransferase 2, mitochondrial
NCBI Official Symbol
GPAT2
NCBI Official Synonym Symbols
CT123
NCBI Protein Information
glycerol-3-phosphate acyltransferase 2, mitochondrial
UniProt Protein Name
Glycerol-3-phosphate acyltransferase 2, mitochondrial
Protein Family
UniProt Gene Name
GPAT2
UniProt Synonym Gene Names
GPAT-2
UniProt Entry Name
GPAT2_HUMAN
Uniprot Description
GPAT2: Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. Belongs to the GPAT/DAPAT family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Transferase; Membrane protein, integral; EC 2.3.1.15; Membrane protein, multi-pass; Mitochondrial; Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: 2q11.1
Cellular Component: integral to membrane; mitochondrial outer membrane; mitochondrion
Molecular Function: glycerol-3-phosphate O-acyltransferase activity
Biological Process: CDP-diacylglycerol biosynthetic process; glycerol-3-phosphate metabolic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process
Research Articles on GPAT2
Similar Products
Product Notes
The GPAT2 gpat2 (Catalog #AAA3209368) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPAT2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPAT2 gpat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATMLEGRCQ TQPRSSPSGR EASLWSSGFG MKLEAVTPFL GKYRPFVGRC. It is sometimes possible for the material contained within the vial of "GPAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
