Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FASTKD3Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlFASTKD3 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human FASTKD3 Polyclonal Antibody | anti-FASTKD3 antibody

FASTKD3 Antibody - N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FASTKD3; Polyclonal Antibody; FASTKD3 Antibody - N-terminal region; anti-FASTKD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME
Sequence Length
662
Applicable Applications for anti-FASTKD3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FASTKD3Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlFASTKD3 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: FASTKD3Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlFASTKD3 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-FASTKD3 antibody
This is a rabbit polyclonal antibody against FASTKD3. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-FASTKD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
FAST kinase domain-containing protein 3, mitochondrial
NCBI Official Synonym Full Names
FAST kinase domains 3
NCBI Official Symbol
FASTKD3
NCBI Protein Information
FAST kinase domain-containing protein 3, mitochondrial
UniProt Protein Name
FAST kinase domain-containing protein 3
UniProt Gene Name
FASTKD3
UniProt Entry Name
FAKD3_HUMAN

NCBI Description

This gene encodes a member of a small family of Fas-activated serine/threonine kinase domain (FASTKD) containing proteins that share an amino terminal mitochondrial targeting domain and multiple carboxy terminal FAST domains as well as a putative RNA-binding RAP domain. The members of this family are ubiquitously expressed and are generally most abundant in mitochondria-enriched tissues such as heart, skeletal muscle and brown-adipose tissue. Some members of this protein family may play a role in apoptosis. The protein encoded by this gene interacts with components of the mitochondrial respiratory and translation networks. A pseudogene of this gene is also present on chromosome 5. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

FASTKD3: Belongs to the FAST kinase family.

Chromosomal Location of Human Ortholog: 5p15.31

Cellular Component: mitochondrion

Molecular Function: protein kinase activity

Biological Process: cellular respiration; protein amino acid phosphorylation

Research Articles on FASTKD3

Similar Products

Product Notes

The FASTKD3 fastkd3 (Catalog #AAA3217539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FASTKD3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FASTKD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FASTKD3 fastkd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HPLGGPVFSQ VSDCDRLEQN VKNEESQMFY RRLSNLTSSE EVLSFISTME. It is sometimes possible for the material contained within the vial of "FASTKD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.