Rabbit GSTZ1 Polyclonal Antibody | anti-GSTZ1 antibody

GSTZ1 antibody - N-terminal region

Cat. Num. AAA3209300

• Gene Names: GSTZ1; MAI; MAAI; MAAID; GSTZ1-1
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Western Blot
• Purity: Protein A purified
• Synonyms: GSTZ1; Polyclonal Antibody; GSTZ1 antibody - N-terminal region; anti-GSTZ1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
• Sequence Length: 216

• Applicable Applications for anti-GSTZ1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTZ1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GSTZ1 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Related Product Information for anti-GSTZ1 antibody

This is a rabbit polyclonal antibody against GSTZ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms.

Product Categories/Family for anti-GSTZ1 antibody

Polyclonal; Drugs and Drug Metabolism; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 22202624
• NCBI GeneID: 2954
• NCBI Accession #: NP_665877
• NCBI GenBank Nucleotide #: NM_145870
• UniProt Accession #: O43708
• Molecular Weight: 24kDa
• NCBI Official Full Name: maleylacetoacetate isomerase isoform 1
• NCBI Official Synonym Full Names: glutathione S-transferase zeta 1
• NCBI Official Symbol: GSTZ1
• NCBI Official Synonym Symbols: MAI; MAAI; MAAID; GSTZ1-1
• NCBI Protein Information: maleylacetoacetate isomerase
• UniProt Protein Name: Maleylacetoacetate isomerase
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTZ1
• UniProt Synonym Gene Names: MAAI; MAAI
• UniProt Entry Name: MAAI_HUMAN

NCBI Description

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq, Jul 2015]

Uniprot Description

GSTZ1: Bifunctional enzyme showing minimal glutathione- conjugating activity with ethacrynic acid and 7-chloro-4- nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T- butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. Belongs to the GST superfamily. Zeta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.2.1.2; EC 2.5.1.18; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Transferase; Other Amino Acids Metabolism - glutathione; Isomerase; Oxidoreductase; Amino Acid Metabolism - tyrosine; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion; cytosol

Molecular Function: protein binding; protein homodimerization activity; glutathione transferase activity; maleylacetoacetate isomerase activity; glutathione peroxidase activity

Biological Process: L-phenylalanine catabolic process; glutathione metabolic process; tyrosine catabolic process; xenobiotic metabolic process