Rabbit anti-Human, Mouse GSTZ1 Polyclonal Antibody | anti-GSTZ1 antibody

GSTZ1 (Glutathione S-transferase zeta 1, Glutathione S-Transferase zeta 1, GSTZ1-1, Maleylacetoacetate Isomerase, MAAI, MAI, MGC2029) (PE)

Cat. Num. AAA6380483

• Gene Names: GSTZ1; MAI; MAAI; MAAID; GSTZ1-1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTZ1; Polyclonal Antibody; GSTZ1 (Glutathione S-transferase zeta 1; Glutathione S-Transferase zeta 1; GSTZ1-1; Maleylacetoacetate Isomerase; MAAI; MAI; MGC2029) (PE); anti-GSTZ1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTZ1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 216

• Applicable Applications for anti-GSTZ1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTZ1, aa1-216 (NP_665877.1).
• Immunogen Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSTZ1 rabbit polyclonal antibody. Western Blot analysis of GSTZ1 expression in human liver.)

Western Blot (WB)

(GSTZ1 rabbit polyclonal antibody. Western Blot analysis of GSTZ1 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 polyclonal antibody. Lane 1: GSTZ1 transfected lysate (24.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GSTZ1 antibody

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms.

Product Categories/Family for anti-GSTZ1 antibody

Antibodies; Enzymes; Isomerase

NCBI and Uniprot Product Information

• NCBI GI #: 22202624
• NCBI GeneID: 2954
• NCBI Accession #: NP_665877.1
• NCBI GenBank Nucleotide #: NM_145870.1
• UniProt Accession #: O43708
• NCBI Official Full Name: maleylacetoacetate isomerase isoform 1
• NCBI Official Synonym Full Names: glutathione S-transferase zeta 1
• NCBI Official Symbol: GSTZ1
• NCBI Official Synonym Symbols: MAI; MAAI; MAAID; GSTZ1-1
• NCBI Protein Information: maleylacetoacetate isomerase
• UniProt Protein Name: Maleylacetoacetate isomerase
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTZ1
• UniProt Synonym Gene Names: MAAI; MAAI
• UniProt Entry Name: MAAI_HUMAN

NCBI Description

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq, Jul 2015]

Uniprot Description

GSTZ1: Bifunctional enzyme showing minimal glutathione- conjugating activity with ethacrynic acid and 7-chloro-4- nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T- butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. Belongs to the GST superfamily. Zeta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.2.1.2; EC 2.5.1.18; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Transferase; Other Amino Acids Metabolism - glutathione; Isomerase; Oxidoreductase; Amino Acid Metabolism - tyrosine; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion; cytosol

Molecular Function: protein binding; protein homodimerization activity; glutathione transferase activity; maleylacetoacetate isomerase activity; glutathione peroxidase activity

Biological Process: L-phenylalanine catabolic process; glutathione metabolic process; tyrosine catabolic process; xenobiotic metabolic process