Western Blot (WB)
(WB Suggested Anti-Fxn AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Fxn Polyclonal Antibody | anti-FXN antibody
Fxn antibody - middle region
Gene Names
Fxn; FA; X25; FARR; Frda
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fxn; Polyclonal Antibody; Fxn antibody - middle region; anti-FXN antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL
Sequence Length
207
Applicable Applications for anti-FXN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Fxn AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Fxn AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-FXN antibody
This is a rabbit polyclonal antibody against Fxn. It was validated on Western Blot
Target Description: Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. It modulates the RNA-binding activity of ACO1.
Target Description: Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. It modulates the RNA-binding activity of ACO1.
Product Categories/Family for anti-FXN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
frataxin, mitochondrial
NCBI Official Synonym Full Names
frataxin
NCBI Official Symbol
Fxn
NCBI Official Synonym Symbols
FA; X25; FARR; Frda
NCBI Protein Information
frataxin, mitochondrial
UniProt Protein Name
Frataxin, mitochondrial
UniProt Gene Name
Fxn
UniProt Synonym Gene Names
Frda; Fxn
Uniprot Description
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 ().
Research Articles on FXN
Similar Products
Product Notes
The FXN fxn (Catalog #AAA3208801) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fxn antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fxn can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FXN fxn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLDNPSSLDE TAYERLAEET LDSLAEFFED LADKPYTLED YDVSFGDGVL. It is sometimes possible for the material contained within the vial of "Fxn, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
