Western Blot (WB)
(WB Suggested Anti-TM4SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit TM4SF4 Polyclonal Antibody | anti-TM4SF4 antibody
TM4SF4 antibody - N-terminal region
Gene Names
TM4SF4; ILTMP; il-TMP
Reactivity
Cow, Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TM4SF4; Polyclonal Antibody; TM4SF4 antibody - N-terminal region; anti-TM4SF4 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG
Sequence Length
202
Applicable Applications for anti-TM4SF4 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TM4SF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TM4SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-TM4SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TM4SF4 antibody
This is a rabbit polyclonal antibody against TM4SF4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene.
Target Description: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene.
Product Categories/Family for anti-TM4SF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
transmembrane 4 L6 family member 4
NCBI Official Synonym Full Names
transmembrane 4 L six family member 4
NCBI Official Symbol
TM4SF4
NCBI Official Synonym Symbols
ILTMP; il-TMP
NCBI Protein Information
transmembrane 4 L6 family member 4
UniProt Protein Name
Transmembrane 4 L6 family member 4
Protein Family
UniProt Gene Name
TM4SF4
UniProt Synonym Gene Names
ILTMP; IL-TMP
UniProt Entry Name
T4S4_HUMAN
NCBI Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation.[provided by RefSeq, Mar 2011]
Research Articles on TM4SF4
Similar Products
Product Notes
The TM4SF4 tm4sf4 (Catalog #AAA3208229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TM4SF4 antibody - N-terminal region reacts with Cow, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's TM4SF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TM4SF4 tm4sf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTGGCARCLG GTLIPLAFFG FLANILLFFP GGKVIDDNDH LSQEIWFFGG. It is sometimes possible for the material contained within the vial of "TM4SF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
