Western Blot (WB)
(WB Suggested Anti-HRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Rabbit HRK Polyclonal Antibody | anti-HRK antibody
HRK antibody - N-terminal region
Gene Names
HRK; DP5; HARAKIRI
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HRK; Polyclonal Antibody; HRK antibody - N-terminal region; anti-HRK antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
Sequence Length
91
Applicable Applications for anti-HRK antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HRK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-HRK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-HRK antibody
This is a rabbit polyclonal antibody against HRK. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 hom
Target Description: Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 hom
Product Categories/Family for anti-HRK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
activator of apoptosis harakiri
NCBI Official Synonym Full Names
harakiri, BCL2 interacting protein
NCBI Official Symbol
HRK
NCBI Official Synonym Symbols
DP5; HARAKIRI
NCBI Protein Information
activator of apoptosis harakiri
UniProt Protein Name
Activator of apoptosis harakiri
Protein Family
UniProt Gene Name
HRK
UniProt Synonym Gene Names
BID3
UniProt Entry Name
HRK_HUMAN
NCBI Description
This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
Uniprot Description
HRK: Promotes apoptosis.
Protein type: Membrane protein, integral; Apoptosis
Chromosomal Location of Human Ortholog: 12q24.22
Cellular Component: mitochondrion; integral to membrane
Molecular Function: protein binding
Biological Process: apoptosis; positive regulation of apoptosis; positive regulation of protein homooligomerization
Research Articles on HRK
Similar Products
Product Notes
The HRK hrk (Catalog #AAA3208175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HRK antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HRK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HRK hrk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MCPCPLHRGR GPPAVCACSA GRLGLRSSAA QLTAARLKAL GDELHQRTMW. It is sometimes possible for the material contained within the vial of "HRK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
