Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STIP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateSTIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit STIP1 Polyclonal Antibody | anti-STIP1 antibody

STIP1 antibody - N-terminal region

Gene Names
STIP1; HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
STIP1; Polyclonal Antibody; STIP1 antibody - N-terminal region; anti-STIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
Sequence Length
543
Applicable Applications for anti-STIP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STIP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateSTIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-STIP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateSTIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-STIP1 antibody
This is a rabbit polyclonal antibody against STIP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Product Categories/Family for anti-STIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
stress-induced-phosphoprotein 1 isoform b
NCBI Official Synonym Full Names
stress induced phosphoprotein 1
NCBI Official Symbol
STIP1
NCBI Official Synonym Symbols
HOP; P60; STI1; STI1L; HEL-S-94n; IEF-SSP-3521
NCBI Protein Information
stress-induced-phosphoprotein 1
UniProt Protein Name
Stress-induced-phosphoprotein 1
UniProt Gene Name
STIP1
UniProt Synonym Gene Names
STI1; Hop
UniProt Entry Name
STIP1_HUMAN

NCBI Description

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009]

Uniprot Description

STI1: a protein that is apparently involved in the response to stress. Specifically interacts with the C-terminal tails of Hsp70 and Hsp90 via TPR1 and TPR2A domains. Deletion of STI1 reduces the activity of the glucocorticoid receptor, a Hsp90 target protein. Phosphorylated in vitro by p90RSK and casein kinase II.

Protein type: Chaperone

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; nucleus

Molecular Function: protein binding

Biological Process: response to stress

Research Articles on STIP1

Similar Products

Product Notes

The STIP1 stip1 (Catalog #AAA3208093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STIP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's STIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STIP1 stip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALEFLNRFEE AKRTYEEGLK HEANNPQLKE GLQNMEARLA ERKFMNPFNM. It is sometimes possible for the material contained within the vial of "STIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.