Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-MAT2A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit MAT2A Polyclonal Antibody | anti-MAT2A antibody

MAT2A antibody - middle region

Gene Names
MAT2A; MATA2; MATII; SAMS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAT2A; Polyclonal Antibody; MAT2A antibody - middle region; anti-MAT2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
Sequence Length
395
Applicable Applications for anti-MAT2A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAT2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MAT2A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-MAT2A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-MAT2A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-MAT2A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-MAT2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateMAT2A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB) (WB Suggested Anti-MAT2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateMAT2A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-MAT2A antibody
This is a rabbit polyclonal antibody against MAT2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.
Product Categories/Family for anti-MAT2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
S-adenosylmethionine synthase isoform type-2
NCBI Official Synonym Full Names
methionine adenosyltransferase 2A
NCBI Official Symbol
MAT2A
NCBI Official Synonym Symbols
MATA2; MATII; SAMS2
NCBI Protein Information
S-adenosylmethionine synthase isoform type-2
UniProt Protein Name
S-adenosylmethionine synthase isoform type-2
UniProt Gene Name
MAT2A
UniProt Synonym Gene Names
AMS2; MATA2; AdoMet synthase 2; MAT 2; MAT-II
UniProt Entry Name
METK2_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the production of S-adenosylmethionine (AdoMet) from methionine and ATP. AdoMet is the key methyl donor in cellular processes. [provided by RefSeq, Jun 2011]

Uniprot Description

MAT2A: Catalyzes the formation of S-adenosylmethionine from methionine and ATP. Belongs to the AdoMet synthase family.

Protein type: EC 2.5.1.6; Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - cysteine and methionine; Transferase

Chromosomal Location of Human Ortholog: 2p11.2

Cellular Component: methionine adenosyltransferase complex; cytosol

Molecular Function: protein binding; methionine adenosyltransferase activity; metal ion binding; ATP binding

Biological Process: methylation; xenobiotic metabolic process; S-adenosylmethionine biosynthetic process; one-carbon compound metabolic process

Research Articles on MAT2A

Similar Products

Product Notes

The MAT2A mat2a (Catalog #AAA3208083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAT2A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAT2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAT2A mat2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLEIVKKNFD LRPGVIVRDL DLKKPIYQRT AAYGHFGRDS FPWEVPKKLK. It is sometimes possible for the material contained within the vial of "MAT2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.