Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ESRRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Rabbit ESRRA Polyclonal Antibody | anti-ESRRA antibody

ESRRA antibody - N-terminal region

Gene Names
ESRRA; ERR1; ERRa; ESRL1; NR3B1; ERRalpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ESRRA; Polyclonal Antibody; ESRRA antibody - N-terminal region; anti-ESRRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN
Sequence Length
423
Applicable Applications for anti-ESRRA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ESRRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ESRRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-ESRRA antibody
This is a rabbit polyclonal antibody against ESRRA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.The protein encoded by this gene is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. A processed pseudogene of ESRRA is located on chromosome 13q12.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
steroid hormone receptor ERR1 isoform 1
NCBI Official Synonym Full Names
estrogen related receptor alpha
NCBI Official Symbol
ESRRA
NCBI Official Synonym Symbols
ERR1; ERRa; ESRL1; NR3B1; ERRalpha
NCBI Protein Information
steroid hormone receptor ERR1
UniProt Protein Name
Steroid hormone receptor ERR1
Protein Family
UniProt Gene Name
ESRRA
UniProt Synonym Gene Names
ERR1; ESRL1; NR3B1; ERR-alpha
UniProt Entry Name
ERR1_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes. A processed pseudogene of ESRRA is located on chromosome 13q12.1. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

ERR1: Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. Belongs to the nuclear hormone receptor family. NR3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: microtubule cytoskeleton; nucleoplasm; intercellular bridge; nucleolus; nucleus

Molecular Function: protein domain specific binding; ligand-dependent nuclear receptor activity; protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; steroid binding

Biological Process: transcription initiation from RNA polymerase II promoter; mitochondrion organization and biogenesis; intracellular receptor-mediated signaling pathway; regulation of osteoblast differentiation; organelle organization and biogenesis; negative regulation of transcription from RNA polymerase II promoter; regulation of cell proliferation; regulation of osteoclast differentiation; regulation of transcription, DNA-dependent; cartilage development; gene expression; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter

Research Articles on ESRRA

Similar Products

Product Notes

The ESRRA esrra (Catalog #AAA3207824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRRA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ESRRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESRRA esrra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEGVRLDRVR GGRQKYKRRP EVDPLPFPGP FPAGPLAVAG GPRKTAAPVN. It is sometimes possible for the material contained within the vial of "ESRRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.