Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADCY8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Rabbit ADCY8 Polyclonal Antibody | anti-ADCY8 antibody

ADCY8 antibody - middle region

Gene Names
ADCY8; AC8; ADCY3; HBAC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADCY8; Polyclonal Antibody; ADCY8 antibody - middle region; anti-ADCY8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ
Sequence Length
1251
Applicable Applications for anti-ADCY8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADCY8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADCY8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-ADCY8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)
Related Product Information for anti-ADCY8 antibody
This is a rabbit polyclonal antibody against ADCY8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
114
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
adenylate cyclase type 8
NCBI Official Synonym Full Names
adenylate cyclase 8
NCBI Official Symbol
ADCY8
NCBI Official Synonym Symbols
AC8; ADCY3; HBAC1
NCBI Protein Information
adenylate cyclase type 8
UniProt Protein Name
Adenylate cyclase type 8
Protein Family
UniProt Gene Name
ADCY8
UniProt Synonym Gene Names
AC8
UniProt Entry Name
ADCY8_HUMAN

NCBI Description

Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase [provided by RefSeq, Jul 2008]

Uniprot Description

ADCY8: This is a membrane-bound, calcium-stimulable adenylyl cyclase. May be involved in learning, in memory and in drug dependence. Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.

Protein type: Transporter; Nucleotide Metabolism - purine; Lyase; Membrane protein, multi-pass; EC 4.6.1.1; Membrane protein, integral; Transporter, aquaporin family; Adenylyl cyclase

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: metal ion binding; calcium- and calmodulin-responsive adenylate cyclase activity; ATP binding; adenylate cyclase activity

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; water transport; activation of protein kinase A; signal transduction; G-protein signaling, adenylate cyclase activating pathway; synaptic transmission; learning and/or memory; long-term memory; phospholipase C activation; energy reserve metabolic process; innate immune response; renal water homeostasis; cAMP biosynthetic process; G-protein signaling, adenylate cyclase inhibiting pathway; transmembrane transport

Research Articles on ADCY8

Similar Products

Product Notes

The ADCY8 adcy8 (Catalog #AAA3207642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADCY8 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADCY8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADCY8 adcy8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIYVKGISEQ EGKIKTYFLL GRVQPNPFIL PPRRLPGQYS LAAVVLGLVQ. It is sometimes possible for the material contained within the vial of "ADCY8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.