Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human HT29 cellsPrimary Antibody Dilution :1:50Secondary Antibody :Donkey anti Rabbit-Alexa Fluor 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: Symplekin Blue: DAPIGene Name :SYMPKSubmitted by :Louise Lagerqvist (PhD), Oncology Department, Institute of Functional Genomics, Montpellier, France. )

Rabbit SYMPK Polyclonal Antibody | anti-SYMPK antibody

SYMPK antibody - N-terminal region

Gene Names
SYMPK; SPK; SYM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SYMPK; Polyclonal Antibody; SYMPK antibody - N-terminal region; anti-SYMPK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW
Sequence Length
1274
Applicable Applications for anti-SYMPK antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SYMPK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human HT29 cellsPrimary Antibody Dilution :1:50Secondary Antibody :Donkey anti Rabbit-Alexa Fluor 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: Symplekin Blue: DAPIGene Name :SYMPKSubmitted by :Louise Lagerqvist (PhD), Oncology Department, Institute of Functional Genomics, Montpellier, France. )

Immunohistochemistry (IHC) (Sample Type :Human HT29 cellsPrimary Antibody Dilution :1:50Secondary Antibody :Donkey anti Rabbit-Alexa Fluor 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: Symplekin Blue: DAPIGene Name :SYMPKSubmitted by :Louise Lagerqvist (PhD), Oncology Department, Institute of Functional Genomics, Montpellier, France. )

Western Blot (WB)

(WB Suggested Anti-SYMPK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-SYMPK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-SYMPK antibody
This is a rabbit polyclonal antibody against SYMPK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SYMPK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
symplekin
NCBI Official Synonym Full Names
symplekin
NCBI Official Symbol
SYMPK
NCBI Official Synonym Symbols
SPK; SYM
NCBI Protein Information
symplekin
UniProt Protein Name
Symplekin
Protein Family
UniProt Gene Name
SYMPK
UniProt Synonym Gene Names
SPK
UniProt Entry Name
SYMPK_HUMAN

NCBI Description

This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. [provided by RefSeq, Jul 2008]

Research Articles on SYMPK

Similar Products

Product Notes

The SYMPK sympk (Catalog #AAA3206602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYMPK antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYMPK can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SYMPK sympk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTHAIKFVEG LIVTLSPRMA DSEIPRRQEH DISLDRIPRD HPYIQYNVLW. It is sometimes possible for the material contained within the vial of "SYMPK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.