Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP4R2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePPP4R2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit PPP4R2 Polyclonal Antibody | anti-PPP4R2 antibody

PPP4R2 antibody - C-terminal region

Gene Names
PPP4R2; PP4R2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP4R2; Polyclonal Antibody; PPP4R2 antibody - C-terminal region; anti-PPP4R2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE
Sequence Length
417
Applicable Applications for anti-PPP4R2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PPP4R2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP4R2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePPP4R2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-PPP4R2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysatePPP4R2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-PPP4R2 antibody
This is a rabbit polyclonal antibody against PPP4R2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
Product Categories/Family for anti-PPP4R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 4 regulatory subunit 2 isoform 1
NCBI Official Synonym Full Names
protein phosphatase 4 regulatory subunit 2
NCBI Official Symbol
PPP4R2
NCBI Official Synonym Symbols
PP4R2
NCBI Protein Information
serine/threonine-protein phosphatase 4 regulatory subunit 2
UniProt Protein Name
Serine/threonine-protein phosphatase 4 regulatory subunit 2
UniProt Gene Name
PPP4R2
UniProt Entry Name
PP4R2_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory subunit of the serine/threonine-protein phosphatase 4 complex. In addition to being required for efficient DNA double strand break repair, this complex plays a role in organization of microtubules at centrosomes and processing of spliceosomal snRNPs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

PPP4R2: a protein of unknown function.

Protein type: Protein phosphatase, regulatory subunit

Chromosomal Location of Human Ortholog: 3p13

Cellular Component: nucleoplasm; centrosome; cytoplasm; nucleus

Molecular Function: protein binding, bridging; protein binding; protein phosphatase type 4 regulator activity

Biological Process: regulation of catalytic activity; RNA splicing; protein modification process; hemopoietic progenitor cell differentiation; mRNA processing

Research Articles on PPP4R2

Similar Products

Product Notes

The PPP4R2 ppp4r2 (Catalog #AAA3206524) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP4R2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP4R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP4R2 ppp4r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSRCTRQHCT EEDEEEDEEE EEESFMTSRE MIPERKNQEK ESDDALTVNE. It is sometimes possible for the material contained within the vial of "PPP4R2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.