Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZGPATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit ZGPAT Polyclonal Antibody | anti-ZGPAT antibody

ZGPAT antibody - C-terminal region

Gene Names
ZGPAT; ZIP; ZC3H9; GPATC6; GPATCH6; ZC3HDC9; KIAA1847
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZGPAT; Polyclonal Antibody; ZGPAT antibody - C-terminal region; anti-ZGPAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Sequence Length
531
Applicable Applications for anti-ZGPAT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZGPAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZGPATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZGPATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ZGPATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZGPATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ZGPAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateZGPAT is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-ZGPAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateZGPAT is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ZGPAT antibody
This is a rabbit polyclonal antibody against ZGPAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
Product Categories/Family for anti-ZGPAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
zinc finger CCCH-type with G patch domain-containing protein isoform a
NCBI Official Synonym Full Names
zinc finger CCCH-type and G-patch domain containing
NCBI Official Symbol
ZGPAT
NCBI Official Synonym Symbols
ZIP; ZC3H9; GPATC6; GPATCH6; ZC3HDC9; KIAA1847
NCBI Protein Information
zinc finger CCCH-type with G patch domain-containing protein
UniProt Protein Name
Zinc finger CCCH-type with G patch domain-containing protein
UniProt Gene Name
ZGPAT
UniProt Synonym Gene Names
GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP
UniProt Entry Name
ZGPAT_HUMAN

Uniprot Description

ZGPAT: Transcription repressor that specifically binds the 5'- GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: negative regulation of epidermal growth factor receptor activity; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on ZGPAT

Similar Products

Product Notes

The ZGPAT zgpat (Catalog #AAA3206503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZGPAT antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ZGPAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZGPAT zgpat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGRHSVASAQ LQEKLAGAQR QLGQLRAQEA GLQQEQRKAD THKKMTEF. It is sometimes possible for the material contained within the vial of "ZGPAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.