Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD8B Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit CD8B Polyclonal Antibody | anti-CD8B antibody

CD8B antibody - middle region

Gene Names
CD8B; LY3; P37; LEU2; LYT3; CD8B1
Reactivity
Dog, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD8B; Polyclonal Antibody; CD8B antibody - middle region; anti-CD8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
Sequence Length
210
Applicable Applications for anti-CD8B antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Rabbit: 93%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD8B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD8B Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-CD8B Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-CD8B antibody
This is a rabbit polyclonal antibody against CD8B. It was validated on Western Blot

Target Description: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
926
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
T-cell surface glycoprotein CD8 beta chain isoform 5
NCBI Official Synonym Full Names
CD8b molecule
NCBI Official Symbol
CD8B
NCBI Official Synonym Symbols
LY3; P37; LEU2; LYT3; CD8B1
NCBI Protein Information
T-cell surface glycoprotein CD8 beta chain
UniProt Protein Name
T-cell surface glycoprotein CD8 beta chain
UniProt Gene Name
CD8B
UniProt Synonym Gene Names
CD8B1
UniProt Entry Name
CD8B_HUMAN

NCBI Description

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq, May 2010]

Uniprot Description

CD8B: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: T cell receptor complex; integral to plasma membrane; early endosome membrane; plasma membrane; extracellular region; external side of plasma membrane

Molecular Function: protein binding; MHC class I protein binding; coreceptor activity

Biological Process: regulation of immune response; T cell activation; viral reproduction; immune response; regulation of defense response to virus by virus; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on CD8B

Similar Products

Product Notes

The CD8B cd8b (Catalog #AAA3206241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD8B antibody - middle region reacts with Dog, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD8B cd8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPEDSGIYFC MIVGSPELTF GKGTQLSVVD FLPTTAQPTK KSTLKKRVCR. It is sometimes possible for the material contained within the vial of "CD8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.