Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL8RBSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human IL8RB Polyclonal Antibody | anti-CXCR2 antibody

IL8RB antibody - N-terminal region

Gene Names
CXCR2; CD182; IL8R2; IL8RA; IL8RB; CMKAR2; CDw128b
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL8RB; Polyclonal Antibody; IL8RB antibody - N-terminal region; anti-CXCR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF
Sequence Length
360
Applicable Applications for anti-CXCR2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL8RB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL8RBSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL8RBSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-CXCR2 antibody
This is a rabbit polyclonal antibody against IL8RB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
C-X-C chemokine receptor type 2
NCBI Official Synonym Full Names
C-X-C motif chemokine receptor 2
NCBI Official Symbol
CXCR2
NCBI Official Synonym Symbols
CD182; IL8R2; IL8RA; IL8RB; CMKAR2; CDw128b
NCBI Protein Information
C-X-C chemokine receptor type 2
UniProt Protein Name
C-X-C chemokine receptor type 2
Protein Family
UniProt Gene Name
CXCR2
UniProt Synonym Gene Names
IL8RB; CXC-R2; CXCR-2; IL-8R B
UniProt Entry Name
CXCR2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]

Uniprot Description

IL-8R B: Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, cytokine

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cell surface; mast cell granule; membrane; integral to plasma membrane; plasma membrane; intracellular

Molecular Function: signal transducer activity; protein binding; interleukin-8 receptor activity; interleukin-8 binding; C-X-C chemokine receptor activity

Biological Process: neutrophil chemotaxis; neutrophil activation; signal transduction; chemotaxis; positive regulation of vascular permeability; negative regulation of neutrophil apoptosis; positive regulation of angiogenesis; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; receptor internalization; midbrain development; positive regulation of cell proliferation; cellular defense response; dendritic cell chemotaxis; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); inflammatory response; acute inflammatory response to antigenic stimulus

Research Articles on CXCR2

Similar Products

Product Notes

The CXCR2 cxcr2 (Catalog #AAA3206133) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL8RB antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL8RB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXCR2 cxcr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEDFNMESDS FEDFWKGEDL SNYSYSSTLP PFLLDAAPCE PESLEINKYF. It is sometimes possible for the material contained within the vial of "IL8RB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.