Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTH1RSample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PTH1R Polyclonal Antibody | anti-PTH1R antibody

PTH1R Antibody - N-terminal region

Gene Names
PTH1R; PFE; EKNS; PTHR; PTHR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTH1R; Polyclonal Antibody; PTH1R Antibody - N-terminal region; anti-PTH1R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLK
Sequence Length
333
Applicable Applications for anti-PTH1R antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human PTH1R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTH1RSample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTH1RSample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PTH1R antibody
This is a rabbit polyclonal antibody against PTH1R. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-PTH1R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
parathyroid hormone/parathyroid hormone-related peptide receptor
NCBI Official Synonym Full Names
parathyroid hormone 1 receptor
NCBI Official Symbol
PTH1R
NCBI Official Synonym Symbols
PFE; EKNS; PTHR; PTHR1
NCBI Protein Information
parathyroid hormone/parathyroid hormone-related peptide receptor
UniProt Protein Name
Parathyroid hormone/parathyroid hormone-related peptide receptor
UniProt Gene Name
PTH1R
UniProt Synonym Gene Names
PTHR; PTHR1; PTH/PTHr receptor
UniProt Entry Name
PTH1R_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]

Uniprot Description

PTHR: This is a receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in PTH1R are the cause of Jansen metaphyseal chondrodysplasia (JMC). JMC is a rare autosomal dominant disorder characterized by a short-limbed dwarfism associated with hypercalcemia and normal or low serum concentrations of the two parathyroid hormones. Defects in PTH1R are the cause of chondrodysplasia Blomstrand type (BOCD). BOCD is a severe skeletal dysplasia. Defects in PTH1R may be a cause of enchondromatosis multiple (ENCHOM). Enchondromas are common benign cartilage tumors of bone. They can occur as solitary lesions or as multiple lesions in enchondromatosis (Ollier and Maffucci diseases). Clinical problems caused by enchondromas include skeletal deformity and the potential for malignant change to osteosarcoma. Defects in PTH1R are the cause of Eiken skeletal dysplasia (EISD); also known as bone modeling defect of hands and feet. It is a rare familial autosomal recessive skeletal dysplasia. It is characterized by multiple epiphyseal dysplasia, with extremely retarded ossification, principally of the epiphyses, pelvis, hands and feet, as well as by abnormal modeling of the bones in hands and feet, abnormal persistence of cartilage in the pelvis and mild growth retardation. Defects in PTH1R are a cause of primary failure of tooth eruption (PFE). PFE is a rare condition that has high penetrance and variable expressivity and in which tooth retention occurs without evidence of any obvious mechanical interference. Instead, malfunction of the eruptive mechanism itself appears to cause nonankylosed permanent teeth to fail to erupt, although the eruption pathway has been cleared by bone resorption. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p22-p21.1

Cellular Component: integral to plasma membrane; brush border membrane; basolateral plasma membrane; apical plasma membrane; cytoplasm; plasma membrane; nucleus; receptor complex

Molecular Function: protein binding; protein self-association; peptide hormone binding; parathyroid hormone receptor activity

Biological Process: cell maturation; G-protein signaling, adenylate cyclase activating pathway; bone mineralization; osteoblast development; G-protein signaling, coupled to cAMP nucleotide second messenger; negative regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; elevation of cytosolic calcium ion concentration; positive regulation of cell proliferation; chondrocyte differentiation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); skeletal development; aging; bone resorption

Disease: Eiken Syndrome; Chondrodysplasia, Blomstrand Type; Failure Of Tooth Eruption, Primary; Metaphyseal Chondrodysplasia, Jansen Type

Research Articles on PTH1R

Similar Products

Product Notes

The PTH1R pth1r (Catalog #AAA3205812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTH1R Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTH1R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTH1R pth1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARIAPGLALL LCCPVLSSAY ALVDADDVMT KEEQIFLLHR AQAQCEKRLK. It is sometimes possible for the material contained within the vial of "PTH1R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.