Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ERI1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit ERI1 Polyclonal Antibody | anti-ERI1 antibody

ERI1 Antibody - N-terminal region

Gene Names
ERI1; HEXO; THEX1; 3'HEXO
Reactivity
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
ERI1; Polyclonal Antibody; ERI1 Antibody - N-terminal region; anti-ERI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD
Sequence Length
38
Applicable Applications for anti-ERI1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ERI1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ERI1Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ERI1 antibody
This is a rabbit polyclonal antibody against THEX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.
Product Categories/Family for anti-ERI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
349
NCBI Official Full Name
3'-5' exoribonuclease 1 isoform 1
NCBI Official Synonym Full Names
exoribonuclease 1
NCBI Official Symbol
ERI1
NCBI Official Synonym Symbols
HEXO; THEX1; 3'HEXO
NCBI Protein Information
3'-5' exoribonuclease 1
UniProt Protein Name
3'-5' exoribonuclease 1
Protein Family
UniProt Gene Name
ERI1
UniProt Synonym Gene Names
3'EXO; THEX1; HEXO
UniProt Entry Name
ERI1_HUMAN

Uniprot Description

THEX1: RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication- dependent histone pre-mRNAs. Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1. Interacts in a cooperative manner with SLBP to the mature 3'-end of histone mRNAs. Binds to 40S and 60S ribosomal subunits and to 80S assembled ribosomes. Found in a ternary complex with SLBP and the stem-loop structure of the 3'-end of histone mRNAs. Although it can bind simultaneously with SLBP to the 3'-end of histone mRNA, the presence of SLBP prevents the exonuclease activity.

Protein type: Hydrolase; EC 3.1.-.-; Nucleolus

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: rRNA binding; 3'-5'-exoribonuclease activity; metal ion binding; ribosome binding; 3'-5' exonuclease activity

Biological Process: RNA-mediated gene silencing; exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); rRNA 3'-end processing

Research Articles on ERI1

Similar Products

Product Notes

The ERI1 eri1 (Catalog #AAA3205681) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERI1 Antibody - N-terminal region reacts with Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ERI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERI1 eri1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKFITSSASD FSDPVYKEIA ITNGCINRMS KEELRAKLSE FKLETRGVKD. It is sometimes possible for the material contained within the vial of "ERI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.