Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: A1CFSample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human A1CF Polyclonal Antibody | anti-A1CF antibody

A1CF Antibody - N-terminal region

Gene Names
A1CF; ACF; ASP; ACF64; ACF65; APOBEC1CF
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
A1CF; Polyclonal Antibody; A1CF Antibody - N-terminal region; anti-A1CF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGW
Sequence Length
659
Applicable Applications for anti-A1CF antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human A1CF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: A1CFSample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: A1CFSample Type: Liver Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-A1CF antibody
This is a rabbit polyclonal antibody against A1CF. It was validated on Western Blot

Target Description: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Alternative splicing occurs at this locus and three full-length transcript variants, encoding three distinct isoforms, have been described. Additional splicing has been observed but the full-length nature of these variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
A1CF protein
NCBI Official Synonym Full Names
APOBEC1 complementation factor
NCBI Official Symbol
A1CF
NCBI Official Synonym Symbols
ACF; ASP; ACF64; ACF65; APOBEC1CF
NCBI Protein Information
APOBEC1 complementation factor
UniProt Protein Name
APOBEC1 complementation factor
UniProt Gene Name
A1CF
UniProt Synonym Gene Names
ACF; ASP
UniProt Entry Name
A1CF_HUMAN

NCBI Description

Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

ACF: Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA processing; RNA-binding; Hydrolase

Chromosomal Location of Human Ortholog: 10q11.23

Cellular Component: nucleoplasm; endoplasmic reticulum; cytoplasm; apolipoprotein B mRNA editing enzyme complex

Molecular Function: protein binding; single-stranded RNA binding; RNA binding; double-stranded RNA binding; nucleotide binding

Biological Process: protein stabilization; cytidine to uridine editing; mRNA modification; gene expression; mRNA processing

Research Articles on A1CF

Similar Products

Product Notes

The A1CF a1cf (Catalog #AAA3205651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A1CF Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A1CF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the A1CF a1cf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGTCPEPEAS MSTAIPGLKK GNNALQSIIL QTLLEKENGQ RKYGGPPPGW. It is sometimes possible for the material contained within the vial of "A1CF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.