Rabbit GAPDH Polyclonal Antibody | anti-GAPDH antibody

GAPDH antibody - N-terminal region

Cat. Num. AAA3205045

• Gene Names: GAPDH; G3PD; GAPD; HEL-S-162eP
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: GAPDH; Polyclonal Antibody; GAPDH antibody - N-terminal region; anti-GAPDH antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
• Sequence Length: 335

• Applicable Applications for anti-GAPDH antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 93%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GAPDH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-GAPDH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: GAPDHSample Type: 293TLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(Host: RabbitTarget Name: GAPDHSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/mlGAPDH is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB)

(Lanes:1. 50 ug NIH3T3 cytosolic extract 2. 50 ug NIH3T3 cytosolic extract 3. 50 ug NIH3T3 cytosolic extract 4. 50 ug NIH3T3 cytosolic extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:30000Gene Name:GAPDHSubmitted by:Dr. Arimdam Basu, Dept. of Animal Biology, University of Pennsylvania)

Western Blot (WB)

(WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB)

(WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji )

Related Product Information for anti-GAPDH antibody

This is a rabbit polyclonal antibody against GAPDH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-GAPDH antibody

Polyclonal; Drugs and Drug Metabolism; Chromatin & Nuclear Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 7669492
• NCBI GeneID: 2597
• NCBI Accession #: NP_002037
• NCBI GenBank Nucleotide #: NM_002046
• UniProt Accession #: Q2TSD0; P04406
• Molecular Weight: 36kDa
• NCBI Official Full Name: glyceraldehyde-3-phosphate dehydrogenase isoform 1
• NCBI Official Synonym Full Names: glyceraldehyde-3-phosphate dehydrogenase
• NCBI Official Symbol: GAPDH
• NCBI Official Synonym Symbols: G3PD; GAPD; HEL-S-162eP
• NCBI Protein Information: glyceraldehyde-3-phosphate dehydrogenase

NCBI Description

This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. Also, this protein contains a peptide that has antimicrobial activity against E. coli, P. aeruginosa, and C. albicans. Studies of a similar protein in mouse have assigned a variety of additional functions including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Many pseudogenes similar to this locus are present in the human genome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]