Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GAPDHSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit GAPDH Polyclonal Antibody | anti-GAPDH antibody

GAPDH antibody - middle region

Gene Names
GAPDH; G3PD; GAPD; HEL-S-162eP
Reactivity
Tested Species Reactivity: Human, Mouse, Rat
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GAPDH; Polyclonal Antibody; GAPDH antibody - middle region; anti-GAPDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse, Rat
Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
Sequence Length
335
Applicable Applications for anti-GAPDH antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GAPDH
Protein Size (#AA)
335 amino acids
Protein Interactions
FUS; HUWE1; UBC; SUMO2; SUMO3; STAU1; MDM2; GAPDH; ASB15; ASB16; RPA3; RPA2; RPA1; EED; SNCA; rev; HSPA9; HSPA1L; GAS7; TUBA1A; TUFM; RAP1GDS1; PPP5C; PPIB; YWHAG; TUBB; TUBA1C; PRPF40A; UBQLN1; DCPS; MAT2B; ACOT7; METAP2; FERMT2; GBP1; EEF1A1; TYMP; DFFA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GAPDHSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GAPDHSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GAPDHSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GAPDHSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GAPDHSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GAPDHSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RatTarget Name: GAPDHSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: GAPDHSample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Lanes:Lane 1-7: 30 ug rat heart extractPrimary Antibody Dilution:1:2000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:GAPDHSubmitted by:Yanfei QI, University of Florida)

Western Blot (WB) (Lanes:Lane 1-7: 30 ug rat heart extractPrimary Antibody Dilution:1:2000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:GAPDHSubmitted by:Yanfei QI, University of Florida)

Western Blot (WB)

(WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB)

(WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji )

Western Blot (WB) (WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji )
Related Product Information for anti-GAPDH antibody
Target Description: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GAPDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
glyceraldehyde-3-phosphate dehydrogenase isoform 1
NCBI Official Synonym Full Names
glyceraldehyde-3-phosphate dehydrogenase
NCBI Official Symbol
GAPDH
NCBI Official Synonym Symbols
G3PD; GAPD; HEL-S-162eP
NCBI Protein Information
glyceraldehyde-3-phosphate dehydrogenase
UniProt Protein Name
Glyceraldehyde-3-phosphate dehydrogenase
UniProt Gene Name
GAPDH
UniProt Synonym Gene Names
GAPD; GAPDH
UniProt Entry Name
G3P_HUMAN

NCBI Description

This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. Also, this protein contains a peptide that has antimicrobial activity against E. coli, P. aeruginosa, and C. albicans. Studies of a similar protein in mouse have assigned a variety of additional functions including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Many pseudogenes similar to this locus are present in the human genome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]

Uniprot Description

GAPDH: a multifunctional enzyme with both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities. A key glycolytic enzyme that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. An important enzyme for energy metabolism, and the production of ATP and pyruvate through anaerobic glycolysis in the cytoplasm. Additionally, it participates in apoptosis, membrane trafficking, iron metabolism, nuclear activities and receptor mediated cell signaling. Its subcellular localization changes reflecting its multiple activities. Is cytosolic, but is also localized in the membrane, the nucleus, polysomes, the ER and the Golgi. Participates in transcription, RNA transport, DNA replication and apoptosis. S-nitrosylation on Cys-152 following apoptotic stimulates its interaction with SIAH2, which in turn moderates its translocation into the nucleus. Mediates cysteine S-nitrosylation of nuclear target proteins including SIRT1, HDAC2 and DNA-PK. Deregulated in lung cancer, renal cancer, breast cancer, gastric cancer, glioma, liver cancer, colorectal cancer, melanoma, prostatic cancer, pancreatic cancer and bladder cancer. Its increased expression and enzymatic activity is associated with cell proliferation and tumorigenesis, Oxidative stress impairs GAPDH catalytic activity and leads to cellular aging and apoptosis. In experimental animal models, injection of GAPDH antagonists induces apoptosis and blocks Hep3B tumor progression, suggesting a therapeutic potential of targeting GAPDH in human hepatocellular carcinoma

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Oxidoreductase; EC 1.2.1.12

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: microtubule cytoskeleton; nuclear membrane; membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasm; plasma membrane; lipid particle; ribonucleoprotein complex; cytosol; nucleus; vesicle

Molecular Function: identical protein binding; protein binding; microtubule binding; glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity; NADP binding; NAD binding

Biological Process: neuron apoptosis; glycolysis; protein stabilization; negative regulation of translation; carbohydrate metabolic process; glucose metabolic process; pathogenesis; microtubule cytoskeleton organization and biogenesis; gluconeogenesis

Research Articles on GAPDH

Similar Products

Product Notes

The GAPDH gapdh (Catalog #AAA3205046) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAPDH antibody - middle region reacts with Tested Species Reactivity: Human, Mouse, Rat Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GAPDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAPDH gapdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAGAHLQGGA KRVIISAPSA DAPMFVMGVN HEKYDNSLKI ISNASCTTNC. It is sometimes possible for the material contained within the vial of "GAPDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.