Western Blot (WB)
(WB Suggested Anti-TRF3 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)
Rabbit anti-Mouse, Rat TRF3 Polyclonal Antibody | anti-TBPL2 antibody
TRF3 antibody - N-terminal region
Gene Names
Tbpl2; Trf3; Gm348
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TRF3; Polyclonal Antibody; TRF3 antibody - N-terminal region; anti-TBPL2 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR
Sequence Length
350
Applicable Applications for anti-TBPL2 antibody
Western Blot (WB)
Homology
Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRF3 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TRF3 Antibody Titration: 5.0ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-TBPL2 antibody
This is a rabbit polyclonal antibody against TRF3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TRF3 is a nuclear protein that is present in all human and mouse tissues and cell lines examined.
Target Description: TRF3 is a nuclear protein that is present in all human and mouse tissues and cell lines examined.
Product Categories/Family for anti-TBPL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
TATA box-binding protein-like protein 2 isoform 1
NCBI Official Synonym Full Names
TATA box binding protein like 2
NCBI Official Symbol
Tbpl2
NCBI Official Synonym Symbols
Trf3; Gm348
NCBI Protein Information
TATA box-binding protein-like protein 2
UniProt Protein Name
TATA box-binding protein-like protein 2
Protein Family
UniProt Gene Name
Tbpl2
UniProt Synonym Gene Names
TBP-like protein 2; TBP-related factor 3
Uniprot Description
Transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
Research Articles on TBPL2
Similar Products
Product Notes
The TBPL2 tbpl2 (Catalog #AAA3203677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRF3 antibody - N-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBPL2 tbpl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FHPHLGGVKK ASTDFSSVDL SFLPDELTQE NRDQTVTGNK LASEESCRTR. It is sometimes possible for the material contained within the vial of "TRF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
