Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-Q9HB14 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Neural CellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit KCNK13 Polyclonal Antibody | anti-KCNK13 antibody

KCNK13 antibody - C-terminal region

Gene Names
KCNK13; THIK1; THIK-1; K2p13.1
Reactivity
Horse, Human, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KCNK13; Polyclonal Antibody; KCNK13 antibody - C-terminal region; anti-KCNK13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
Sequence Length
408
Applicable Applications for anti-KCNK13 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-Q9HB14 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Neural CellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-Q9HB14 AntibodyParaffin Embedded Tissue: Human BrainCellular Data: Neural CellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Researcher: Delphine Bichet, University of Nice-Sophia-AntipolisApplication: IHCSpecies + Tissue/Cell type: MDCK CellsPrimary antibody dilution: 1:100Secondary antibody: Anti-rabbit-Alexa488Secondary antibody dilution: 1:1000)

Immunohistochemistry (IHC) (Researcher: Delphine Bichet, University of Nice-Sophia-AntipolisApplication: IHCSpecies + Tissue/Cell type: MDCK CellsPrimary antibody dilution: 1:100Secondary antibody: Anti-rabbit-Alexa488Secondary antibody dilution: 1:1000)

Western Blot (WB)

(Host: RabbitTarget Name: KCNK13Sample Type: 721_BAntibody Dilution: 1.0ug/mlKCNK13 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: KCNK13Sample Type: 721_BAntibody Dilution: 1.0ug/mlKCNK13 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-KCNK13 Antibody Titration: 0.12ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNK13 Antibody Titration: 0.12ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-KCNK13 antibody
This is a rabbit polyclonal antibody against KCNK13. It was validated on Western Blot and immunohistochemistry

Target Description: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.
Product Categories/Family for anti-KCNK13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
potassium channel subfamily K member 13
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 13
NCBI Official Symbol
KCNK13
NCBI Official Synonym Symbols
THIK1; THIK-1; K2p13.1
NCBI Protein Information
potassium channel subfamily K member 13
UniProt Protein Name
Potassium channel subfamily K member 13
UniProt Gene Name
KCNK13
UniProt Synonym Gene Names
THIK-1
UniProt Entry Name
KCNKD_HUMAN

NCBI Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a potassium channel containing two pore-forming domains. This protein is an open channel that can be stimulated by arachidonic acid and inhibited by the anesthetic halothane. [provided by RefSeq, Jul 2013]

Uniprot Description

KCNK13: Potassium channel displaying weak inward rectification in symmetrical K(+) solution. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32.11

Cellular Component: plasma membrane; integral to membrane

Molecular Function: potassium channel activity; voltage-gated ion channel activity

Biological Process: synaptic transmission

Research Articles on KCNK13

Similar Products

Product Notes

The KCNK13 kcnk13 (Catalog #AAA3202540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNK13 antibody - C-terminal region reacts with Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK13 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KCNK13 kcnk13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GEMISMKDLL AANKASLAIL QKQLSEMANG CPHQTSTLAR DNEFSGGVGA. It is sometimes possible for the material contained within the vial of "KCNK13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.