Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRMT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRMT1 is expressed in HEK293T)

Rabbit TRMT1 Polyclonal Antibody | anti-TRMT1 antibody

TRMT1 antibody - N-terminal region

Gene Names
TRMT1; TRM1; MRT68
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRMT1; Polyclonal Antibody; TRMT1 antibody - N-terminal region; anti-TRMT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AMENGTGPYGEERPREVQETTVTEGAAKIAFPSANEVFYNPVQEFNRDLT
Sequence Length
659
Applicable Applications for anti-TRMT1 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 93%; Guinea Pig: 92%; Horse: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRMT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRMT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRMT1 is expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-TRMT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that TRMT1 is expressed in HEK293T)
Related Product Information for anti-TRMT1 antibody
This is a rabbit polyclonal antibody against TRMT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRMT1 dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Product Categories/Family for anti-TRMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
tRNA (guanine(26)-N(2))-dimethyltransferase isoform 1
NCBI Official Synonym Full Names
tRNA methyltransferase 1
NCBI Official Symbol
TRMT1
NCBI Official Synonym Symbols
TRM1; MRT68
NCBI Protein Information
tRNA (guanine(26)-N(2))-dimethyltransferase
UniProt Protein Name
tRNA (guanine(26)-N(2))-dimethyltransferase
Protein Family
UniProt Gene Name
TRMT1
UniProt Entry Name
TRM1_HUMAN

NCBI Description

This gene encodes a tRNA-modifying enzyme that acts as a dimethyltransferase, modifying a single guanine residue at position 26 of the tRNA. The encoded enzyme has both mono- and dimethylase activity when exogenously expressed, and uses S-adenosyl methionine as a methyl donor. The C-terminal region of the encoded protein has both a zinc finger motif, and an arginine/proline-rich region. Mutations in this gene have been implicated in autosomal recessive intellectual disorder (ARID). Alternative splicing results in multiple transcript variants encoding different isoforms. There is a pseudogene of this gene on the X chromosome. [provided by RefSeq, May 2017]

Uniprot Description

Function: Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.

Catalytic activity: 2 S-adenosyl-L-methionine + guanine26 in tRNA = 2 S-adenosyl-L-homocysteine + N(2)-dimethylguanine26 in tRNA.

Sequence similarities: Belongs to the class I-like SAM-binding methyltransferase superfamily. Trm1 family.Contains 1 C3H1-type zinc finger.Contains 1 Trm1 methyltransferase domain.

Research Articles on TRMT1

Similar Products

Product Notes

The TRMT1 trmt1 (Catalog #AAA3202144) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRMT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRMT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMT1 trmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AMENGTGPYG EERPREVQET TVTEGAAKIA FPSANEVFYN PVQEFNRDLT. It is sometimes possible for the material contained within the vial of "TRMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.