Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)

Rabbit FABP4 Polyclonal Antibody | anti-FABP4 antibody

FABP4 antibody - middle region

Gene Names
FABP4; aP2; ALBP; AFABP; A-FABP; HEL-S-104
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FABP4; Polyclonal Antibody; FABP4 antibody - middle region; anti-FABP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
Sequence Length
132
Applicable Applications for anti-FABP4 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Goat: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 85%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FABP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Related Product Information for anti-FABP4 antibody
This is a rabbit polyclonal antibody against FABP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles incl

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
fatty acid-binding protein, adipocyte
NCBI Official Synonym Full Names
fatty acid binding protein 4
NCBI Official Symbol
FABP4
NCBI Official Synonym Symbols
aP2; ALBP; AFABP; A-FABP; HEL-S-104
NCBI Protein Information
fatty acid-binding protein, adipocyte
UniProt Protein Name
Fatty acid-binding protein, adipocyte
UniProt Gene Name
FABP4
UniProt Synonym Gene Names
ALBP; A-FABP; AFABP
UniProt Entry Name
FABP4_HUMAN

NCBI Description

FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP4: a lipid transport protein that is the predominant fatty acid binding protein found in adipocytes. Also expressed in macrophages. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. Homodimer. Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. Interacts with PPARG. Monomer. FABP4 knockout mice fed a high-fat and high-calorie diet become obese but develop neither insulin resistance nor diabetes, suggesting that this protein might be a link between obesity and insulin resistance and diabetes. Mice deficient in both FABP4 and ApoE show protection against atherosclerosis when compared with mice deficient only in ApoE. Mice carrying a FABP4 genetic variant exhibit both reduced FABP4 expression and a reduced potential for developing type 2 diabetes and coronary heart disease. A related study in humans indicated a similar pattern, suggesting that FABP4 may be a potential therapeutic target in the treatment of these disorders. Belongs to the calycin superfamily,fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: cytoplasm; lipid particle; nucleus

Molecular Function: transporter activity; fatty acid binding

Biological Process: cholesterol homeostasis; transport; white fat cell differentiation; triacylglycerol catabolic process; brown fat cell differentiation; negative regulation of protein kinase activity; cytokine production; negative regulation of transcription, DNA-dependent; positive regulation of inflammatory response

Research Articles on FABP4

Similar Products

Product Notes

The FABP4 fabp4 (Catalog #AAA3201719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FABP4 antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FABP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FABP4 fabp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDEVTADDRK VKSTITLDGG VLVHVQKWDG KSTTIKRKRE DDKLVVECVM. It is sometimes possible for the material contained within the vial of "FABP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.