Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Liver )

Rabbit CLDN1 Polyclonal Antibody | anti-CLDN1 antibody

CLDN1 antibody - C-terminal region

Gene Names
CLDN1; CLD1; SEMP1; ILVASC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CLDN1; Polyclonal Antibody; CLDN1 antibody - C-terminal region; anti-CLDN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Sequence Length
211
Applicable Applications for anti-CLDN1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Liver )

Immunohistochemistry (IHC) (Human Liver )
Related Product Information for anti-CLDN1 antibody
This is a rabbit polyclonal antibody against CLDN1. It was validated on Western Blot and immunohistochemistry

Target Description: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. This protein, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
Product Categories/Family for anti-CLDN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
claudin-1
NCBI Official Synonym Full Names
claudin 1
NCBI Official Symbol
CLDN1
NCBI Official Synonym Symbols
CLD1; SEMP1; ILVASC
NCBI Protein Information
claudin-1
UniProt Protein Name
Claudin-1
Protein Family
UniProt Gene Name
CLDN1
UniProt Synonym Gene Names
CLD1; SEMP1
UniProt Entry Name
CLD1_HUMAN

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

Claudin-1: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Acts as a co- receptor for HCV entry into hepatic cells. Can form homo- and heteropolymers with other CLDN. Homopolymers interact with CLDN3, but not CLDN2, homopolymers. Directly interacts with TJP1/ZO-1, TJP2/ZO-2 and TJP3/ZO-3. Interacts with MPDZ and INADL. May interact with HCV E1 and E2 proteins. Strongly expressed in liver and kidney. Expressed in heart, brain, spleen, lung and testis. Belongs to the claudin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cytoskeletal

Chromosomal Location of Human Ortholog: 3q28-q29

Cellular Component: tight junction; integral to plasma membrane; apical plasma membrane; integral to membrane; lateral plasma membrane

Molecular Function: identical protein binding; protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; viral reproduction; cell adhesion; calcium-independent cell-cell adhesion

Disease: Ichthyosis, Leukocyte Vacuoles, Alopecia, And Sclerosing Cholangitis

Research Articles on CLDN1

Similar Products

Product Notes

The CLDN1 cldn1 (Catalog #AAA3201639) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLDN1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CLDN1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CLDN1 cldn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQALFTGWAA ASLCLLGGAL LCCSCPRKTT SYPTPRPYPK PAPSSGKDYV. It is sometimes possible for the material contained within the vial of "CLDN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.