Immunohistochemistry (IHC)
(Human kidney )
Rabbit ZNF24 Polyclonal Antibody | anti-ZNF24 antibody
ZNF24 antibody - middle region
Gene Names
ZNF24; KOX17; RSG-A; ZNF191; ZSCAN3; Zfp191
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF24; Polyclonal Antibody; ZNF24 antibody - middle region; anti-ZNF24 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGR
Sequence Length
368
Applicable Applications for anti-ZNF24 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF24
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Western Blot (WB)
(WB Suggested Anti-ZNF24 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZNF24 is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-ZNF24 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that ZNF24 is expressed in Jurkat)
Related Product Information for anti-ZNF24 antibody
This is a rabbit polyclonal antibody against ZNF24. It was validated on Western Blot and immunohistochemistry
Target Description: ZNF24 is a new candidate transcription factor.
Target Description: ZNF24 is a new candidate transcription factor.
Product Categories/Family for anti-ZNF24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
zinc finger protein 24 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 24
NCBI Official Symbol
ZNF24
NCBI Official Synonym Symbols
KOX17; RSG-A; ZNF191; ZSCAN3; Zfp191
NCBI Protein Information
zinc finger protein 24
UniProt Protein Name
Zinc finger protein 24
Protein Family
UniProt Gene Name
ZNF24
UniProt Synonym Gene Names
KOX17; ZNF191; ZSCAN3; RSG-A
UniProt Entry Name
ZNF24_HUMAN
Uniprot Description
ZNF24: a probable transcriptional regulator of the krueppel C2H2-type zinc-finger protein family.
Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor
Chromosomal Location of Human Ortholog: 18q12
Cellular Component: nucleoplasm; nucleus
Molecular Function: protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription factor activity
Biological Process: myelination; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent
Research Articles on ZNF24
Similar Products
Product Notes
The ZNF24 znf24 (Catalog #AAA3201572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF24 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF24 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF24 znf24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CDDDGRTENG ALAPKQELPS ALESHEVPGT LSMGVPQIFK YGETCFPKGR. It is sometimes possible for the material contained within the vial of "ZNF24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
