Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF280B AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit ZNF280B Polyclonal Antibody | anti-ZNF280B antibody

ZNF280B antibody - N-terminal region

Gene Names
ZNF280B; SUHW2; ZNF279; ZNF632; 5'OY11.1; D87009.C22.3
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF280B; Polyclonal Antibody; ZNF280B antibody - N-terminal region; anti-ZNF280B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP
Sequence Length
543
Applicable Applications for anti-ZNF280B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Goat: 90%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF280B AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-ZNF280B AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-ZNF280B antibody
This is a rabbit polyclonal antibody against ZNF280B. It was validated on Western Blot

Target Description: ZNF280B contains 4 C2H2-type zinc fingers. It may function as a transcription factor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
zinc finger protein 280B
NCBI Official Synonym Full Names
zinc finger protein 280B
NCBI Official Symbol
ZNF280B
NCBI Official Synonym Symbols
SUHW2; ZNF279; ZNF632; 5'OY11.1; D87009.C22.3
NCBI Protein Information
zinc finger protein 280B
UniProt Protein Name
Zinc finger protein 280B
Protein Family
UniProt Gene Name
ZNF280B
UniProt Synonym Gene Names
SUHW2; ZNF279; ZNF632
UniProt Entry Name
Z280B_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor that upregulates expression of MDM2, which negatively regulates p53 expression. This gene is highly expressed in prostate cancer cells, which leads to a reduction in p53 levels and an increase in growth of the cancer cells. Several transcript variants have been found for this gene, but only one of them is protein-coding. [provided by RefSeq, Jan 2015]

Uniprot Description

Function: May function as a transcription factor.

Subcellular location: Nucleus

Potential.

Sequence similarities: Contains 4 C2H2-type zinc fingers.

Sequence caution: The sequence BAA20005.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on ZNF280B

Similar Products

Product Notes

The ZNF280B znf280b (Catalog #AAA3200813) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF280B antibody - N-terminal region reacts with Cow, Dog, Goat, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF280B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF280B znf280b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEEKEPEPQK NIQETKQVDD EDAELIFVGV EHVNEDAELI FVGVTSNSKP. It is sometimes possible for the material contained within the vial of "ZNF280B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.