Rabbit SLC26A3 Polyclonal Antibody | anti-SLC26A3 antibody

SLC26A3 antibody - middle region

Cat. Num. AAA3200515

• Gene Names: SLC26A3; CLD; DRA
• Reactivity: Tested Reactivity: Human; Predicted Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: SLC26A3; Polyclonal Antibody; SLC26A3 antibody - middle region; anti-SLC26A3 antibody

• Host: Rabbit
• Reactivity: Tested Reactivity: Human; Predicted Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
• Sequence: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF

• Applicable Applications for anti-SLC26A3 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Protein Size (# AA): 764 amino acids
• Protein Interactions: SLC9A3R1; SLC9A3R2
• Blocking Peptide: For anti-SLC26A3 (MBS3200515) antibody is Catalog MBS3225568
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3
• Predicted Homology: Cow: 100%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 100%
• Replacement Item: This antibody may replace item sc-114083 from Santa Cruz Biotechnology.
• Preparation and Storage: For short term use, store at 2°C to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(HeartRabbit Anti-SLC26A3 AntibodyCatalog Number: MBS3200515Formalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: MembranePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC)

(LiverCatalog Number: MBS3200515Rabbit Anti-SLC26A3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(Human HepG2Host: RabbitTarget Name: SLC26A3Sample Type: HepG2Antibody Dilution: 1.0ug/mlSLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(Human PancreasWB Suggested Anti-SLC26A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB)

(Human HeartWB Suggested Anti-SLC26A3 antibody Titration: 1 ug/mLSample Type: Human heart)

Related Product Information for anti-SLC26A3 antibody

SLC26A3 is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-SLC26A3 antibody

Polyclonal; Transcription Factor; Transcription Regulation; Membrane Protein; Transcription Regulation; Disease Related; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4557535
• NCBI GeneID: 1811
• NCBI Accession #: NP_000102
• NCBI GenBank Nucleotide #: NM_000111
• UniProt Accession #: P40879
• Molecular Weight: 84kDa
• NCBI Official Full Name: chloride anion exchanger
• NCBI Official Synonym Full Names: solute carrier family 26 member 3
• NCBI Official Symbol: SLC26A3
• NCBI Official Synonym Symbols: CLD; DRA
• NCBI Protein Information: chloride anion exchanger
• UniProt Protein Name: Chloride anion exchanger
• Protein Family: Chloride anion exchanger
• UniProt Gene Name: SLC26A3
• UniProt Synonym Gene Names: DRA; Protein DRA

NCBI Description

The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea. [provided by RefSeq, Oct 2008]

Uniprot Description

Chloride/bicarbonate exchanger. Mediates the efficient absorption of chloride ions in the colon, participating in fluid homeostasis. Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation.