Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TFCP2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit TFCP2 Polyclonal Antibody | anti-TFCP2 antibody

TFCP2 antibody - N-terminal region

Gene Names
TFCP2; LSF; SEF; LBP1C; LSF1D; TFCP2C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TFCP2; Polyclonal Antibody; TFCP2 antibody - N-terminal region; anti-TFCP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT
Sequence Length
502
Applicable Applications for anti-TFCP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TFCP2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-TFCP2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-TFCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-TFCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-TFCP2 antibody
This is a rabbit polyclonal antibody against TFCP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TFCP2 binds a variety of cellular and viral promoters including fibrinogen, alpha-globin, SV40 and HIV-1 promoters. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with UBP1. It also functions as part of the SSP (stage selector protein) complex. TFCP2 facilitates the interaction of the gamma-globin genes with enhancer elements contained in the locus control region in fetal erythroid cells. It interacts by binding to the stage selector element (SSE) in the proximal gamma-globin promoter.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
alpha-globin transcription factor CP2 isoform 1
NCBI Official Synonym Full Names
transcription factor CP2
NCBI Official Symbol
TFCP2
NCBI Official Synonym Symbols
LSF; SEF; LBP1C; LSF1D; TFCP2C
NCBI Protein Information
alpha-globin transcription factor CP2
UniProt Protein Name
Alpha-globin transcription factor CP2
Protein Family
UniProt Gene Name
TFCP2
UniProt Synonym Gene Names
LSF; SEF
UniProt Entry Name
TFCP2_HUMAN

NCBI Description

This gene encodes a transcription factor that binds the alpha-globin promoter and activates transcription of the alpha-globin gene. The encoded protein regulates erythroid gene expression, plays a role in the transcriptional switch of globin gene promoters, and it activates many other cellular and viral gene promoters. The gene product interacts with certain inflammatory response factors, and polymorphisms of this gene may be involved in the pathogenesis of Alzheimer's disease. [provided by RefSeq, Mar 2010]

Research Articles on TFCP2

Similar Products

Product Notes

The TFCP2 tfcp2 (Catalog #AAA3200335) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFCP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TFCP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TFCP2 tfcp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSMSDVLALP IFKQEESSLP PDNENKILPF QYVLCAATSP AVKLHDETLT. It is sometimes possible for the material contained within the vial of "TFCP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.