Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-YWHAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit YWHAB Polyclonal Antibody | anti-YWHAB antibody

YWHAB antibody - middle region

Gene Names
YWHAB; HS1; GW128; YWHAA; KCIP-1; HEL-S-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
YWHAB; Polyclonal Antibody; YWHAB antibody - middle region; anti-YWHAB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVF
Sequence Length
246
Applicable Applications for anti-YWHAB antibody
Western Blot (WB)
Homology
Cow: 87%; Dog: 87%; Guinea Pig: 87%; Horse: 80%; Human: 87%; Mouse: 87%; Rabbit: 87%; Rat: 87%; Sheep: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human YWHAB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-YWHAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-YWHAB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-YWHAB antibody
This is a rabbit polyclonal antibody against YWHAB. It was validated on Western Blot

Target Description: YWHAB belongs to the 14-3-3 family, members of which mediate signal transduction by binding to phosphoserine-containing proteins. YWHAB has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
14-3-3 protein beta/alpha
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
NCBI Official Symbol
YWHAB
NCBI Official Synonym Symbols
HS1; GW128; YWHAA; KCIP-1; HEL-S-1
NCBI Protein Information
14-3-3 protein beta/alpha
UniProt Protein Name
14-3-3 protein beta/alpha
Protein Family
UniProt Gene Name
YWHAB
UniProt Synonym Gene Names
KCIP-1
UniProt Entry Name
1433B_HUMAN

NCBI Description

This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

14-3-3 beta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: focal adhesion; cytoplasmic vesicle membrane; membrane; transcriptional repressor complex; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus; cytosol

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; enzyme binding; histone deacetylase binding; protein complex binding; phosphoprotein binding; transcription corepressor activity; phosphoserine binding

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of protein amino acid dephosphorylation; positive regulation of catalytic activity; axon guidance; fibroblast growth factor receptor signaling pathway; activation of MAPKK activity; nerve growth factor receptor signaling pathway; apoptosis; protein heterooligomerization; MAPKKK cascade; small GTPase mediated signal transduction; Ras protein signal transduction; insulin receptor signaling pathway; cytoplasmic sequestering of protein; innate immune response; gene expression; vascular endothelial growth factor receptor signaling pathway; negative regulation of transcription, DNA-dependent; protein targeting

Research Articles on YWHAB

Similar Products

Product Notes

The YWHAB ywhab (Catalog #AAA3200264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YWHAB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's YWHAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YWHAB ywhab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTERNEKKQQ MGKEYREKIE AELQDICNDV LELLDKYLIP NATQPESKVF. It is sometimes possible for the material contained within the vial of "YWHAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.