Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RGS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)

Rabbit RGS9 Polyclonal Antibody | anti-RGS9 antibody

RGS9 antibody - middle region

Gene Names
RGS9; PERRS; RGS9L
Reactivity
Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RGS9; Polyclonal Antibody; RGS9 antibody - middle region; anti-RGS9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES
Sequence Length
674
Applicable Applications for anti-RGS9 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Horse: 85%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RGS9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RGS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-RGS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Spleen)
Related Product Information for anti-RGS9 antibody
This is a rabbit polyclonal antibody against RGS9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Product Categories/Family for anti-RGS9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
regulator of G-protein signaling 9 isoform 1
NCBI Official Synonym Full Names
regulator of G protein signaling 9
NCBI Official Symbol
RGS9
NCBI Official Synonym Symbols
PERRS; RGS9L
NCBI Protein Information
regulator of G-protein signaling 9
UniProt Protein Name
Regulator of G-protein signaling 9
UniProt Gene Name
RGS9
UniProt Synonym Gene Names
RGS9
UniProt Entry Name
RGS9_HUMAN

NCBI Description

This gene encodes a member of the RGS family of GTPase activating proteins that function in various signaling pathways by accelerating the deactivation of G proteins. This protein is anchored to photoreceptor membranes in retinal cells and deactivates G proteins in the rod and cone phototransduction cascades. Mutations in this gene result in bradyopsia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]

Uniprot Description

RGS9: belongs to the 'regulator of G protein signaling' family. Inhibits signal transduction by increasing the GTPAse activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(t)-alpha. Involved in phototransduction; key element in the recovery phase of visual transduction. Four alternatively spliced isoforms have been described.

Protein type: GAPs, RGS; GAPs

Chromosomal Location of Human Ortholog: 17q24

Cellular Component: cytoplasm; plasma membrane; heterotrimeric G-protein complex; nucleus

Molecular Function: signal transducer activity; protein complex binding; GTPase activator activity

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; nervous system development; regulation of rhodopsin mediated signaling; visual perception; response to estrogen stimulus; dopamine receptor signaling pathway; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Disease: Prolonged Electroretinal Response Suppression

Research Articles on RGS9

Similar Products

Product Notes

The RGS9 rgs9 (Catalog #AAA3200196) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS9 antibody - middle region reacts with Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RGS9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RGS9 rgs9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKSKRVANFF QIKMDVPTGS GTCLMDSEDA GTGESGDRAT EKEVICPWES. It is sometimes possible for the material contained within the vial of "RGS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.