Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

MMP1 recombinant protein

Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein

Gene Names
MMP1; CLG; CLGN
Applications
Western Blot, ELISA
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
MMP1; Recombinant Human MMP1 Protein; Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein; CLGN; CLG1; Collagenase; Interstitial Collagenase; Vertebrate Collagenase; Fibroblast Collagenase; MMP1 recombinant protein
Ordering
For Research Use Only!
Host
E. coli AA 101-469 (P03956).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
In 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.
Concentration
0.8 mg/mL (varies by lot)
Sequence Positions
101-469
Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Sequence Length
469
Applicable Applications for MMP1 recombinant protein
Western Blot (WB), ELISA (EIA)
Source
Human
Predicted Molecular Mass
Predicted MW: 46.5 kDa
Observed MW: 46.5 kDa
Protein Residues
with N-terminal 6×His-tag.
Usage
MMP1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.

**Avoid repeated freeze-thaw cycles.**

Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

SDS-PAGE

SDS-PAGE
Related Product Information for MMP1 recombinant protein
MMP-1 is produced by fibroblasts, chondrocytes, macrophages, endothelial cells, and osteoblasts. It is induced by the pro-inflammatory cytokines IL-1 and TNF-alpha, various growth factors such as EGF, PDGF, FGF basic, and Oncostatin M, chemical agents such as cAMP and phorbol esters and events occurring at the cell surface such as cell fusion and phagocytosis. MMP-1 plays a significant role in the degradation of different types of collagen in extracellular matrix remodeling. It is implicated in a variety of processes involving collagen degradation such as emphysema, atherosclerosis, rheumatoid and osteoarthritis, periodontal and respiratory disease, angiogenesis and tumorigenesis, tissue remodeling and wound healing, and inflammatory bowel disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interstitial collagenase isoform 1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 1
NCBI Official Symbol
MMP1
NCBI Official Synonym Symbols
CLG; CLGN
NCBI Protein Information
interstitial collagenase
UniProt Protein Name
Interstitial collagenase
Protein Family
UniProt Gene Name
MMP1
UniProt Synonym Gene Names
CLG; MMP-1
UniProt Entry Name
MMP1_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP1: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.

Protein type: EC 3.4.24.7; Motility/polarity/chemotaxis; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: extracellular region

Molecular Function: endopeptidase activity; metalloendopeptidase activity; serine-type endopeptidase activity

Biological Process: cellular protein metabolic process; collagen catabolic process; extracellular matrix disassembly; leukocyte migration; positive regulation of protein oligomerization; proteolysis

Disease: Epidermolysis Bullosa Dystrophica, Autosomal Recessive; Pulmonary Disease, Chronic Obstructive

Research Articles on MMP1

Similar Products

Product Notes

The MMP1 mmp1 (Catalog #AAA286117) is a Recombinant Protein produced from E. coli AA 101-469 (P03956). and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 101-469. AAA Biotech's MMP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Researchers should empirically determine the suitability of the MMP1 mmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLTEGNPRWE QTHLTYRIEN YTPDLPRADV DHAIEKAFQL WSNVTPLTFT KVSEGQADIM ISFVRGDHRD NSPFDGPGGN LAHAFQPGPG IGGDAHFDED ERWTNNFREY NLHRVAAHEL GHSLGLSHST DIGALMYPSY TFSGDVQLAQ DDIDGIQAIY GRSQNPVQPI GPQTPKACDS KLTFDAITTI RGEVMFFKDR FYMRTNPFYP EVELNFISVF WPQLPNGLEA AYEFADRDEV RFFKGNKYWA VQGQNVLHGY PKDIYSSFGF PRTVKHIDAA LSEENTGKTY FFVANKYWRY DEYKRSMDPG YPKMIAHDFP GIGHKVDAVF MKDGFFYFFH GTRQYKFDPK TKRILTLQKA NSWFNCRKN. It is sometimes possible for the material contained within the vial of "MMP1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.