Source: Prokaryotic expression
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. The loss of this protein is less than 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012]
Uniprot Description
CYGB: May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer. Belongs to the globin family.
Chromosomal Location of Human Ortholog: 17q25
Cellular Component: neuron projection; cell soma; cytoplasm
Molecular Function: peroxidase activity; iron ion binding; heme binding; oxygen binding; oxygen transporter activity
Biological Process: oxygen transport; response to oxidative stress
Research Articles on CYGB
Similar Products
Product Notes
The CYGB cygb (Catalog #AAA2030418) is a Recombinant Protein produced from Host: E Coli Source: Prokaryotic expression and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Cytoglobin can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CYGB cygb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.MEKVPGEME IERRERSEEL SEAERKAVQA MWARLYANCE DVGVAILVRF FVNFPSAKQY FSQFKHMEDP LEMERSPQLR KHACRVMGAL NTVVENLHDP DKVSSVLALV GKAHALKHKV EPVYFKILSG VILEVVAEEF ASDFPPETQR AWAKLRGLIY SHVTAAYKEV GWVQQVPNAT TPPATLPSSG P. It is sometimes possible for the material contained within the vial of "Cytoglobin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.
Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.